KEGG   Streptomyces alfalfae: A7J05_20020Help
Entry
A7J05_20020       CDS       T05110                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00071  Fatty acid degradation
ssia00280  Valine, leucine and isoleucine degradation
ssia00281  Geraniol degradation
ssia00310  Lysine degradation
ssia00360  Phenylalanine metabolism
ssia00362  Benzoate degradation
ssia00380  Tryptophan metabolism
ssia00410  beta-Alanine metabolism
ssia00627  Aminobenzoate degradation
ssia00640  Propanoate metabolism
ssia00650  Butanoate metabolism
ssia00903  Limonene and pinene degradation
ssia00930  Caprolactam degradation
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
ssia01120  Microbial metabolism in diverse environments
ssia01130  Biosynthesis of antibiotics
ssia01212  Fatty acid metabolism
Module
ssia_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A7J05_20020
   00650 Butanoate metabolism
    A7J05_20020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7J05_20020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7J05_20020
   00310 Lysine degradation
    A7J05_20020
   00360 Phenylalanine metabolism
    A7J05_20020
   00380 Tryptophan metabolism
    A7J05_20020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7J05_20020
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A7J05_20020
   00281 Geraniol degradation
    A7J05_20020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7J05_20020
   00627 Aminobenzoate degradation
    A7J05_20020
   00930 Caprolactam degradation
    A7J05_20020
Enzymes [BR:ssia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A7J05_20020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: APY87696
UniProt: A0A1P8TJ97
LinkDB All DBs
Position
4790106..4790840
Genome map
AA seq 244 aa AA seqDB search
MSLVVSSPARGVVTVTLDVPERRNALSADLVGALSEALGDLGGDPAVRAVLLAHTGPAFC
SGADLKAPPAPHDFVRLLRQVVELPKPVIARVDGHVRAGGIGLLGACDMAVAGPGASFAL
TEVHIGVAPAVISLTLLPRVDPAAASRYCLTGERFEGPEAARIGLVTAYASDVDATLGPL
LDGVRRAAPGALAETKKLLTARVLDAFDDQSDAVVALSARLFGSAEAREGMAAFLERRER
PWVL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgtcgtctcctcgccggcacgaggcgtcgtcaccgtcaccctggacgtcccc
gagcgccgcaacgcgctctccgccgacctggtgggagccctgagcgaggcgctgggcgac
ctcggcggcgaccccgccgtccgcgcggtcctgctcgcccacaccgggccggcgttctgc
tcgggcgcggacctgaaggcgccgcccgcaccgcacgacttcgtacggctcctgcggcag
gtcgtcgagctgcccaagccggtgatcgcccgcgtggacggccatgtgcgggcgggcggc
atcgggctgctcggcgcgtgcgacatggcggtggcgggccccggcgcgtccttcgcgctc
acggaggtccacatcggcgtcgcccccgccgtgatctccctgacgctgctgccccgcgtc
gacccggccgccgcgtcccgctactgcctcaccggggagcgcttcgaggggccggaagcg
gcccggatcggcctcgtcaccgcgtacgcgtccgacgtcgacgccacgctcggaccgctg
ctcgacggggtgcggcgggccgcgccgggagccctggccgagacgaagaagctgctcacg
gctagggtgctcgacgcattcgacgaccaatcggacgctgtcgtcgccctgtcggcgcgg
ctcttcggctccgccgaggcgcgcgaggggatggcggcgttcctcgaacgacgggagcgc
ccatgggtgctgtga

DBGET integrated database retrieval system