KEGG   Streptomyces alfalfae: A7J05_21140Help
Entry
A7J05_21140       CDS       T05110                                 

Definition
(GenBank) hypothetical protein
Organism
ssia  Streptomyces alfalfae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH-4 XOO_2897-deam
Motif
Other DBs
NCBI-ProteinID: APY87877
UniProt: A0A1P8TJR4
LinkDB All DBs
Position
5053102..5056005
Genome map
AA seq 967 aa AA seqDB search
MVTFAQAQERAEEWINGDVPGYQHREVRVREFDLGFVVWAEDRENGPVSDGGDQRLVIAR
DSGEATLWPGLAVGEVIRRYEEEYGLPASAPQDAVPPPPERVDLNQTSFLLSPPEWLQEA
ADKLGIPDRRSEGSSSAAASASDAGADAGADAASGPAAGPASDEGVPADAEPADAPAPAA
SVPGGGTPWPAAGGSDADDAPERDDSLPVTSPGVPTGATPWAGTDTNADAGEDHSVPLPA
TVFSPPLAGLDGGTPPPGVAPEAKTALMHGGSQLPATAIAPAVDDPNTPGSPQPGVPDVP
RPPAGAPVPNAPRPPAGSATPPPGAAAYGYPQGPGVPQPPAGVPVANAPQPPAGSATPPP
GAAAYGYPQGPGVPQPPAGASVANAPQPPAGSATPPPGAPGADAASGDAQGPSHGARGGS
ATPPPPSPAGAPGGAPQASGPGAPGTPAGGYVPTQLVSSLGPEGPRPPAAPGAPQPPGPP
GAPGGTPPGGVHHAATMLADPSLSGGIKPPGAPGAPQPPGPPGTPGPPQPPGPPGAPGGP
PAGGVHHAATMLADPSLGGGLKPPSAPQPPGAPQPPGAPQPPGGSVHHAATMLAGPAVGG
PGMPPPPPAAPGRPMPPGQPGPPGPVPQGPPGQPYGYPQPPAGRPTVGPGYQAVLRYRAA
DGSEQQLIRRSAPGTPHPEWQILHELRGMNVPPQQVLELHTELESCELPGAYCARMIRET
WPQARITSIAPYGRDHASRQQGMQQLLAHQGELHQVADGPARPAPVRAPLQQLPPAPPIP
PEGVAQELAGAFGPGVFRFDQRAVSRQGVPDIVAHTLVVAGLPVDFGPFFWAQAQPGRPV
PTLAELAQERGVQPASDAGSYLVMGSDFGRALCVQYGTANIVAVPVEAGPGGAPVPPQFV
NTGLPEFARCMALLGRMWRLRFGLNQEQAGRWTVDFQNQLAALDPAALGSPESWWSVLLE
QMWDGLL
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccttcgcgcaggcgcaggagcgcgccgaggagtggatcaacggcgacgtgccg
ggctaccagcaccgtgaggtgcgggtccgggagttcgacctggggttcgtggtctgggcc
gaggaccgggagaacggtccggtctccgacggcggcgaccagcggctcgtcatcgccagg
gacagcggcgaggccacgctgtggccggggctcgccgtgggcgaggtgatccgccggtac
gaggaggagtacggcctgccggcctcggcgccgcaggacgcggttccgccgccgccggag
cgggtcgacctcaaccagacgtccttcttgttgagccctccggagtggctccaggaggcg
gcggacaagctgggcattccggatcggcggtcggaggggtcgtcttcggcggcggcctcg
gcttccgatgcgggtgcggatgcgggtgcggacgcggcttccggcccggctgccggcccg
gcctcggacgagggtgtcccggcggacgcggagccggccgacgcgccggctcccgcggcg
tccgtgccggggggcggcacgccgtggcccgcggccggtggctccgacgccgacgacgcg
cccgagcgcgacgacagcctgcccgtgacgtcgccgggcgtgccgacgggcgcgaccccg
tgggccggtacggacaccaacgccgacgcgggcgaggaccactcggtcccgctgcccgcc
acggtgttctcaccgccgctcgccggtctggacggcggcactccgccgcccggcgtcgcc
ccggaggccaagacggccctgatgcacggcggcagccaactccccgcgacggcgatcgcc
ccggccgtggacgacccgaacactcccggctccccgcagccgggggtccccgacgtcccg
cggccgcctgccggtgctccggtgccgaacgccccgcggccgcccgcgggttcggcgacg
ccgccgcccggtgccgccgcgtacggctatccgcagggtcccggcgttccgcagccgcct
gccggtgttccggtggccaacgccccgcagccgcccgcgggttcggcgacgccgccgccc
ggtgccgccgcgtacggctatccgcagggtcccggcgttccgcagccgcccgccggtgct
tcggtggccaacgccccgcagccgcccgccggttccgcgacgccgcctcccggtgcgccg
ggtgccgatgccgccagcggcgacgcgcaggggccgtcgcacggggcgcggggaggcagt
gccacgccgccgcctccgagcccggcgggtgcgcccggtggtgcgccgcaggcctccggg
cccggggctcccggtacgcccgccgggggctatgtgccgacccagctcgtctcctcgctc
ggccccgaggggccgcgcccgcccgcggctcctggcgcgccgcagccgcccggtccgccc
ggcgctccggggggcacgcctcccggtggtgtgcaccatgccgcgacgatgctggccgac
ccgagtctcagcggcgggatcaagccgccgggtgcgcccggcgccccgcagcccccggga
ccgcccggcactccggggccgccgcagccgcccggtccgcccggcgctccggggggcccg
cctgccggtggtgtgcaccatgccgcgacgatgctggccgacccgagcctcggcggcggg
ctcaagccgccgagcgcgccccagcccccgggtgcgccccagcctcccggcgctccgcag
ccgcccggtggctctgtgcaccacgccgcgacgatgctggcgggccccgcggtcggcggt
cccggcatgccgcccccgcccccggccgcgccgggccggccgatgccgccggggcagccg
ggcccgcccggtccggtgccgcagggcccgcccggtcagccgtacggctatccgcagccg
cccgccggccggcccaccgtcggccccggctaccaggccgtgctgcgctaccgcgcggcc
gacggttccgagcagcagctcatccgccgctcggcgcccggcaccccgcacccggagtgg
cagatcctgcacgagctgcgcggcatgaacgtgcccccgcagcaggtgctggagctccac
accgagctggagtcctgcgagctgccgggcgcctactgcgcccggatgatccgcgagacc
tggccgcaggcgcggatcacgtcgatcgccccgtacggcagggaccacgcgtcccggcag
cagggcatgcagcagctcctcgcgcaccagggcgagctgcaccaggtcgcggacggcccg
gcccgcccggcgccggtgcgtgccccgttgcagcagctgccgcccgccccgccgatcccg
ccggagggcgtcgcgcaggagctggccggggccttcgggccgggcgtcttccgcttcgac
cagcgggcggtgtcgcgccagggcgtgccggacatcgtggcgcacaccctggtggtggcg
gggctgcccgtcgacttcgggccgttcttctgggcgcaggcccagccggggcgtccggtg
ccgacgctggcggagctggcgcaggagcggggtgtgcagccggcgtcggacgcgggctcg
tacctggtcatgggcagcgacttcggccgggcgctctgcgtccagtacggcacggcgaac
atcgtggccgtgccggtggaggccggtcccggcggcgctcccgtgccgccgcagttcgtg
aacacgggcctgccggagttcgcgcgctgcatggccctgctcggccgcatgtggcggctg
cgcttcggcctgaaccaggagcaggcgggccgctggaccgtcgacttccagaaccagctc
gccgctctcgacccggcggcgctgggctcgccggagagctggtggtcggtcctgctcgaa
cagatgtgggacgggttgctgtag

DBGET integrated database retrieval system