KEGG   Streptomyces alfalfae: A7J05_25265Help
Entry
A7J05_25265       CDS       T05110                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
ssia  Streptomyces alfalfae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: APY88555
UniProt: A0A1P8TLR6
LinkDB All DBs
Position
5994481..5995971
Genome map
AA seq 496 aa AA seqDB search
MTELVEHGQLVIGGELVDPLGKGVIDVVSPHTGQVFARVPHAAPADVDRAVATARKAFDE
GPWPRMTVDERIEVVTRIKDGFAARHEEIARVISSENGTPYTSSVMVQALAAMMVWDAAL
TVARGFTYEERRDGALGELLVRREPMGVVAAVVPWNVPQFTAAAKLAPALLAGCPVILKT
SPEAPLDAYILAEIAAEAGLPAGVLSVICADREVSEHLVGHPGVDKVSFTGSVAAGKRVM
EVAARNLTRVTLELGGKSAAIVLPDADAASAVAGIAPFAWMINGQACVAQTRILVPRTRY
DEFAEAFAAAASGLKVGDPMDPATELGPLVAERQRRRSLDYIRIGQEEGAKILAGGGRPA
GLDQGWYVEPTLFGGVDNTMRVAREEIFGPVICLLPYGDEDEAVRIADDSDYGLSGSVWT
ADVERGIDVARRVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEYFEHKMIHLP
AAYAPPADAAEPGAGA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacggagctcgtggaacacggacagctggtcatcggcggtgagctggtcgacccgctc
ggcaagggcgtcatcgacgtcgtctcgccgcacaccggccaggtcttcgcccgcgtcccg
cacgcggcccccgccgacgtggaccgcgccgtcgccaccgcgcgcaaggcgttcgacgaa
ggcccttggccgcgcatgaccgtggacgagcggatcgaggtcgtcaccaggatcaaggac
ggcttcgcggcgcggcacgaggagatcgcccgcgtcatcagctccgagaacggcaccccg
tacacctccagcgtcatggtgcaggccctcgccgccatgatggtctgggacgcggcgctc
accgtcgcccgcggcttcacctacgaggagcggcgcgacggagcgctcggcgagctcctc
gtccgccgcgagcccatgggcgtcgtcgcggccgtcgtgccgtggaacgtcccgcagttc
accgccgccgccaagctcgcgcccgcgctcctcgccggctgcccggtgatcctcaagacg
tcgccggaagcgcccctggacgcgtacatcctcgcggagatcgccgcggaagccggcctg
cccgccggcgtgctctcggtcatctgcgccgaccgcgaggtcagcgagcacctcgtcggg
caccctggcgtcgacaaggtgtccttcaccggctccgtcgccgcgggaaagcgcgtcatg
gaggtcgccgcccgcaacctcacgcgcgtcaccctcgaactcggcggcaagtccgccgcg
atcgtgctgcccgacgccgacgcggcgagcgccgtcgcgggcatcgcccccttcgcctgg
atgatcaacggccaggcctgcgtggcccagacccgcatcctggtgccccgcacgcgctac
gacgagttcgccgaggccttcgccgccgccgcctccggactcaaggtcggcgaccccatg
gaccccgcgaccgaactcggtccgctggtcgccgagcgccagcggcggcgctccctcgac
tacatccgcatcggccaggaggagggcgcgaagatcctcgcgggtggcggccgccccgcg
gggctcgaccagggctggtacgtcgaaccgaccctcttcggcggcgtcgacaacacgatg
cgcgtcgcccgcgaggaaatcttcggacccgtgatctgcctgctgccgtacggcgacgag
gacgaggccgtgcggatcgccgacgactccgactacgggctcagcggcagcgtctggacg
gcggacgtcgagcgcggcatcgacgtcgcccggcgggtgcgcaccggcacgtactccgtg
aacaccttcagcctcgacatgctcggccccttcggcggctacaagaactccggcctgggg
cgggagttcggacccgaggggtacggcgagtacttcgagcacaagatgatccatctcccc
gcggcgtatgcgccacccgccgacgcggcggagccgggggcgggcgcctga

DBGET integrated database retrieval system