KEGG   Streptomyces alfalfae: A7J05_29155Help
Entry
A7J05_29155       CDS       T05110                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00020  Citrate cycle (TCA cycle)
ssia00480  Glutathione metabolism
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
ssia01120  Microbial metabolism in diverse environments
ssia01130  Biosynthesis of antibiotics
ssia01200  Carbon metabolism
ssia01210  2-Oxocarboxylic acid metabolism
ssia01230  Biosynthesis of amino acids
Module
ssia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssia_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A7J05_29155
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7J05_29155
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A7J05_29155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: APY89224
UniProt: A0A1P8TNV8
LinkDB All DBs
Position
6859891..6862110
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATHSFLPVVQAYASTAGVSVETRDISLAGRIIASFPERLDEGQ
RINDALAELGELAKTPQANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGEND
FRSTEKSAVISEAGSLRIELTGDDGSTTVLRESVPVLAGEVVDASVMRVAALREFLKEQV
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAAYGDVLAAAGLTPNDGLGGI
FKGLDSLADGEKIKASFEAELAEGPELAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGAEHDTLAVLPDSSYAGIYQVVIDDCRANGAFDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPATGTVRVVDGAGEVVLEQTVAAGDIFRMCQTKDAPIQDWVKLAVTRARATGS
PAVFWLDESRAHDAVLIGKVERYLADHETEGLDIRVMSPVEATAFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTGNARAQILADTLDRATATFLENDKSPSRRLGGIDNRGSHFY
LGLYWAQELAKQTEDAELAEAFAALAKTLSEQEQAIVDELIAVQGSPADIGGYYQPDAAK
ASAVMRPSATLNQALSILG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacccacactgacgaggccccggccctggcgacccat
tcgttcttgccggtggtccaggcctacgcctcgacggcgggtgtcagcgtggagacccgc
gacatctcgctcgcgggccgcatcatcgcgagcttccccgagcgtctcgatgagggccag
cgcatcaacgacgccctcgccgagctcggcgaactcgccaagacgccgcaggcgaacatc
atcaagctgccgaacatctcggcctcgatcccgcagctcaaggccgcgatcgccgagctg
cagggccagggctacgcgctccccgactacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgcccccgcgtcggtcaagaactacgccaaggcccacccgcac
cgcatgggcgcctggacggccgactccaagacgaacgtcgccaccatgggcgagaacgac
ttccgctcgaccgagaagtccgcggtcatctccgaggccggctccctgcgcatcgagctg
accggtgacgacggctccaccacggtcctgcgcgagtccgtgccggtcctcgcgggcgag
gtcgtcgacgcctccgtgatgcgcgtcgccgcgctccgcgagttcctcaaggagcaggtc
gcccgcgccaaggccgagggcgtcctcttctccgtgcacctcaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtggtccgtgccttcttcccgaagaccttcgcc
gcgtacggcgacgtcctcgccgccgccggcctgaccccgaacgacggtctcggcggcatc
ttcaagggcctggactcgctggccgacggcgagaagatcaaggcgtccttcgaggccgag
ctggccgagggccccgagctcgccatggtcgactccgacaagggcatcaccaacctgcac
gtccccagcgacgtcatcgtggacgcctccatgccggccatgatccgcacctccggccac
atgtggggcccggacggcgccgagcacgacaccctcgccgtcctcccggacagcagctac
gcgggcatctaccaggtcgtcatcgacgactgccgcgccaacggcgccttcgacccgtcg
acgatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccggccacgggcaccgtgcgcgtcgtcgacggagcgggc
gaggtcgtcctggagcagaccgtcgccgccggtgacatcttccgcatgtgccagaccaag
gacgcgccgatccaggactgggtgaagctcgccgtcacccgcgcccgtgccaccggcagc
ccggccgtcttctggctggacgagagccgcgcccacgacgccgtgctcatcggcaaggtc
gagcgctacctcgccgaccacgagaccgagggcctggacatccgggtcatgtcgccggtc
gaggccaccgcgttctccctggagcgcatccggcggggcgaggacaccatctccgtcacc
ggcaacgtcctgcgcgactacctcacggacctcttcccgatcctggagctgggcaccagc
gccaagatgctctcggtggtcccgctgatgaacggcggcggcctcttcgagacgggcgcg
ggcggctcggccccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
agcctgggcgagttcctggccctcgcggtcagcttcgagcacctggccaccaccacgggc
aacgcgcgcgcccagatcctggccgacaccctggaccgcgccacagccacgttcctggag
aacgacaagtcgccgagccgtcgcctcggcggcatcgacaaccgcggcagccacttctac
ctcggcctgtactgggcgcaggagctggccaagcagaccgaggacgcggagctcgccgag
gcgttcgccgccctcgccaagacgctctccgagcaggagcaggccatcgtcgacgagctg
atcgcggtgcagggcagcccggccgacatcggcggctactaccagcccgacgcggccaag
gcctccgcggtcatgcgcccgtccgcgacgctcaaccaggcgctgtcgatcctgggctga

DBGET integrated database retrieval system