KEGG   Streptomyces alfalfae: A7J05_34735Help
Entry
A7J05_34735       CDS       T05110                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00250  Alanine, aspartate and glutamate metabolism
ssia00410  beta-Alanine metabolism
ssia00430  Taurine and hypotaurine metabolism
ssia00650  Butanoate metabolism
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
ssia01120  Microbial metabolism in diverse environments
ssia02024  Quorum sensing
Module
ssia_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A7J05_34735
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A7J05_34735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7J05_34735
   00430 Taurine and hypotaurine metabolism
    A7J05_34735
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A7J05_34735
Enzymes [BR:ssia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A7J05_34735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: APY90139
UniProt: A0A1P8TR75
LinkDB All DBs
Position
complement(8105333..8106763)
Genome map
AA seq 476 aa AA seqDB search
MPVQQPHHDRGESRDLEINPVFSREPLRVPRYALPEREMEPDTAYQVIHDELMLDGNARQ
NLATFVSTWAEPQARRLMSECVQKNMIDKDEYPQTAELERRCVHMLARLWHAEAPHQAMG
CSTTGSSEAAMLGGLALKRRWQHRRRAKGEPTDRPNLVMGINVQICWEKFADYFEVEPRY
VPMEGDRYHLTPDKAVELCDENTIGVVAVLGSTFDGSYEPVADIASALDELQSRTGLDIP
IHVDGASGGMIAPFLDPDLAWDFRLPRVASINTSGHKYGLVMPGVGWALWRDEDALPDDL
VFHVNYLGGDMPTFALNFSRPGAQIVAQYYNFLRLGFDGYRRVQQTCRDVATRLAGEIAG
LGPFELITDGSRLPVFAFRMRDGVDHFSVFDVSAALRERGWLVPAYTFPKNRTDLAVLRV
VVRNGFSHDLADLLLDDLRRVLPRLDEQGEPHRGEDDAGGFAHGAETKNPVRPGRH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgcagcagccccaccacgatcgcggcgagagccgggacctggagatcaacccg
gtattcagtcgcgagcccctgcgggtgccgcggtacgcgctgccggagcgcgagatggag
ccggacaccgcctaccaagtgatccacgacgagctgatgctcgacggcaacgcccggcag
aacctggcgaccttcgtctcgacgtgggcggagccccaggcgcggcggctgatgagcgag
tgcgtccagaagaacatgatcgacaaggacgagtatccgcagaccgccgagctggagcgc
cggtgcgtgcacatgctcgcccggttgtggcatgcggaggcgccccaccaggcaatgggc
tgctcgacgaccgggtcgagtgaggcggcgatgctgggcggcctggccctcaaacggcgc
tggcagcaccggcgccgcgccaagggcgaaccgaccgaccggccgaacctcgtcatgggc
atcaacgtgcagatctgctgggagaagttcgccgactacttcgaggtcgagccgcgctac
gtacccatggagggcgaccgctaccacctcacccccgacaaggcggtcgagctgtgcgac
gagaacaccatcggcgtcgtcgccgtgctcggctccaccttcgacggctcctacgagccc
gtcgccgacatcgcctcggccctggacgagttgcagtcccgcaccggcctggacatcccc
atccatgtcgacggcgcctccggagggatgatcgccccgttcctcgatcccgatctcgca
tgggacttccggctgccgcgggtcgcctccatcaacacctccgggcacaagtacggcctg
gtcatgcccggtgtcggctgggccctgtggcgcgatgaggacgcccttcccgacgatctc
gtcttccacgtcaattacctcggcggcgacatgccgaccttcgcgctgaacttctcccgc
cccggcgcgcagatcgtcgcgcagtactacaacttcctgcgtctcggcttcgacggttac
cgcagggtgcagcagacctgccgcgacgtggccacccggctcgccggagagatcgccggg
ctcggcccgttcgagctgatcaccgacggcagccggctcccggtcttcgccttccggatg
cgcgacggcgtcgaccacttcagcgtcttcgacgtctccgccgcactgcgcgagcgcggc
tggctggtgcccgcgtacaccttccccaagaaccgcaccgacctggccgtcctgcgcgtc
gtggtccgcaacggcttcagccacgacctggccgacctgctcctggacgacctgcggcgt
gttcttccccggctggacgagcagggcgagccccaccgcggcgaggacgacgccggcggc
ttcgcccacggcgcggagaccaagaaccccgtccgtcccggccgccactga

DBGET integrated database retrieval system