KEGG   Staphylococcus simulans: AL483_01750Help
Entry
AL483_01750       CDS       T04303                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00010  Glycolysis / Gluconeogenesis
ssif00053  Ascorbate and aldarate metabolism
ssif00071  Fatty acid degradation
ssif00280  Valine, leucine and isoleucine degradation
ssif00310  Lysine degradation
ssif00330  Arginine and proline metabolism
ssif00340  Histidine metabolism
ssif00380  Tryptophan metabolism
ssif00410  beta-Alanine metabolism
ssif00561  Glycerolipid metabolism
ssif00620  Pyruvate metabolism
ssif00625  Chloroalkane and chloroalkene degradation
ssif01100  Metabolic pathways
ssif01110  Biosynthesis of secondary metabolites
ssif01120  Microbial metabolism in diverse environments
ssif01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL483_01750
   00053 Ascorbate and aldarate metabolism
    AL483_01750
   00620 Pyruvate metabolism
    AL483_01750
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL483_01750
   00561 Glycerolipid metabolism
    AL483_01750
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL483_01750
   00310 Lysine degradation
    AL483_01750
   00330 Arginine and proline metabolism
    AL483_01750
   00340 Histidine metabolism
    AL483_01750
   00380 Tryptophan metabolism
    AL483_01750
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL483_01750
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AL483_01750
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AL483_01750
Enzymes [BR:ssif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AL483_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AMG95603
LinkDB All DBs
Position
348231..349661
Genome map
AA seq 476 aa AA seqDB search
MRIQTKQYINGEWVDSASGETIDVINPATEEVLGQVAKGNKEDVDKAVQAAKDVYLEFRH
SSVEYRRDLLDKIVKEYENRKQDIIEAITDELGSPLEKSENVHYQMGLNHFSEARDALDN
FQFEERRGNDLVVKEGIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSELTPYAAI
ILAEIFDKAGVPKGVFNLVNGDGEGVGNPLSEHPDVRMMSFTGSGRTGAKIMEKAAQDFK
KVSLELGGKSPYIILDDADVEEAAEAAVGKVYNNTGQVCTAGTRTIIPESMKDKFIEAAK
EKMSQVKVGDPREEGVQMGPIISKKQFDQVEDYIQKGIDEGAELVFGGVGKPEGLDKGYF
AKPTIFANVDNQMTIAQEEIFGPVMSIITYKDLKGAIEIANETKYGLAGYVYGKDLNTLR
KVAREVEAGTIEINEAGRKPDLPFGGYKQSGIGREWGDYGIEEFLEIKSIAGYYNE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgagaattcaaactaagcaatatatcaatggtgaatgggttgatagtgcaagtggcgaa
acaatcgatgtcatcaacccagcaactgaagaagtactcggtcaagttgcgaaaggtaac
aaagaagacgtagataaagcagtccaagctgcaaaagatgtttatcttgaattccgtcac
agcagtgtagaatatagaagagacttactcgataaaattgtcaaagagtatgaaaataga
aaacaagatattatagaagcgattactgatgaactaggttcaccgcttgaaaaatccgaa
aatgtgcattatcaaatggggcttaatcacttctcagaagcaagagatgcattggataat
tttcaatttgaagaacgacgcggtaatgacttagtggtgaaagagggtattggtgttgct
ggtttaatcacaccatggaacttcccaactaaccaaacatcattaaaactagcagcagca
ttcgcagctggtagtccagtcgtattaaaaccttctgaattaacaccatacgcagcaatt
atcttagctgaaatctttgataaagctggtgtgccaaaaggtgtattcaacttagtaaat
ggtgacggcgaaggtgtcggcaatccattaagtgaacatccagatgtacgcatgatgtca
ttcacaggttcaggacgtacaggtgctaaaatcatggaaaaagcagcacaagacttcaaa
aaagtttcacttgaacttggtggtaaatcaccttatatcattttagatgatgcagatgta
gaagaagctgctgaagctgcagtcggcaaagtttataacaacacaggccaagtatgtact
gcaggtacaagaactattattcctgaatcaatgaaagataaattcattgaagcagcaaaa
gaaaaaatgagccaagtaaaagttggagatccaagagaagaaggcgttcaaatgggtcca
atcatcagcaaaaaacaatttgatcaagttgaagattatattcaaaaaggtatcgatgaa
ggtgctgaattagtttttggcggtgtaggcaaacctgaaggattagacaaaggttacttc
gcaaaaccaacaatctttgcgaatgttgataaccaaatgactatcgcacaagaagaaatc
tttggacctgtaatgtcaattatcacttacaaagaccttaaaggagcaattgaaattgcg
aacgaaacaaaatatggtcttgctggttatgtatatggtaaagacttaaacactttacgc
aaagttgcacgtgaagttgaagcaggtacaattgaaatcaatgaagcaggtcgcaaacca
gatttaccattcggtggttataaacaatcaggtatcggtagagaatggggcgattatggt
attgaagaattcttagaaatcaaatcaattgcaggttactataatgaataa

DBGET integrated database retrieval system