KEGG   Staphylococcus simulans: AL483_05710Help
Entry
AL483_05710       CDS       T04303                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssif  Staphylococcus simulans
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssif01001]
    AL483_05710 (pknB)
Enzymes [BR:ssif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AL483_05710 (pknB)
Protein kinases [BR:ssif01001]
 Serine/threonine kinases: Other
  Bacterial family
   AL483_05710 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Pkinase_fungal Kdo Kinase-like FTA2 Haspin_kinase Choline_kinase SIN1_PH
Motif
Other DBs
NCBI-ProteinID: AMG97610
LinkDB All DBs
Position
complement(1152864..1154858)
Genome map
AA seq 664 aa AA seqDB search
MIGSTISERYKIIEFLGGGGMSNVYLAEDLILETKVAVKMIHIAPHEKEDMVRRFEREVH
NTSRLSHDNVVSVKDVGEDHEYFYLVMEYIEGPTLSEYIKTHGPLSIETAVNFAQQILEG
IQHAHEMGIVHRDIKPQNILVDRHKTLKILDFGIAKALSETAMTQTSHVLGTVQYLSPEQ
AKGEATDKRTDIYSIGIVLYEMLVGEPPFTGETAVSIAIKHIQDQMPNPTDIRPNIPQAL
SNVILKATEKDRDKRYQDIESMQRDLSSALEKCREDETPYVSDEADTKTIAIDKAAIAKE
TKDNEPIHQTMEIPIVNQQRFQSTEGPVYEVPKKRRSKKKKFFFALIFALLLISLISFIA
YGLLGNKYIETPDLRGKTEAQAEQILKEHHIKVGKTKRAYSDKYQENQIITTDPAPGERV
EEHGTVNIVLSKGPQKAQMPNLYGTSKTEALKLLDELGFKHISVEQAYSKTKLERGLIEN
QNIAADTEVPINDTHIVLTESLGVKQVYVKDYTGESYDKAEKELQDKGLKPVKEKEVHSD
KVEKGKIISQSPKSKSIDEDSTVTFVVSLGKDDGKDEDKADDNPSVKDVTQTVQVPYSGE
DKERQKVEVFVRDKDHDGSSAVQTFHINSNRSISIPLKIEKGKTACYTVRVDDKIVADKD
VAYD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgattggttcaactatcagcgaacgttataaaattatagaattcttaggtggaggcggc
atgagtaatgtctacctcgctgaagatttgatcttagagactaaagttgcggtcaaaatg
attcatattgcgccacatgaaaaagaagacatggtgagacgatttgaacgtgaagtgcat
aatacatctcgtctctcacatgataatgttgtcagtgtcaaagatgtcggagaagaccac
gaatatttctacttagtgatggaatatatcgaaggtccgacactctccgaatatataaaa
acacatggtcctttaagtattgaaacagcggttaacttcgcacaacaaatacttgaaggc
attcaacatgcacatgaaatgggtatcgtacatagagacattaaacctcaaaatatttta
gtagaccgacataagacattaaaaatcttagacttcggtattgctaaagcgttaagtgaa
acagccatgacccaaaccagccatgtgctcggtactgtgcaatatctttcacctgaacaa
gcgaaaggtgaagcaacagacaaacgtacggatatttattcgatcggaattgtcttatat
gaaatgttagtcggtgaaccgccattcactggagaaacagctgtcagtatcgccatcaaa
catattcaagaccaaatgccgaacccgacagatatccgtccaaatatcccgcaagcgctc
agcaacgtgattttaaaagcgactgaaaaagatagagacaaacgctatcaagatattgaa
agtatgcaacgtgatttaagcagtgcgttagaaaaatgtcgtgaagatgaaacaccttat
gtttcagatgaagcagatactaaaaccatcgcgattgataaagcagcaatcgcaaaagaa
actaaagataatgaaccgattcatcaaacaatggaaattccaattgtgaatcaacaacgt
ttccaaagtacagaaggtcctgtttatgaagtacctaaaaaacgtcggtctaaaaagaaa
aagttcttctttgcgttaattttcgcgttattgttaatcagtcttatcagctttattgcg
tacggcttattaggaaataaatatatcgaaactccagacttgcgcggtaaaacagaagca
caagctgaacagattttaaaagaacatcatattaaagtaggcaaaacaaaacgggcttat
agtgataagtatcaagaaaatcaaattatcacaacagatcctgcaccaggtgagcgtgta
gaagaacatggcaccgtaaatatcgtgttgtctaaaggtccgcaaaaagcacaaatgcct
aacttatacggtacaagtaaaacggaagcattgaagctattagatgaacttggtttcaaa
catatctcagtagaacaagcatactctaagactaaattagaacgtggtttgattgaaaac
caaaatatagcggctgataccgaagtaccgattaatgatacacatatcgtactgactgaa
tctttaggtgtgaaacaagtgtatgtcaaagattatacaggtgaaagctatgacaaagca
gaaaaagaactgcaagataaaggcttgaaaccagtaaaagaaaaagaagtacacagtgat
aaagtcgaaaaaggcaagattatttcgcaatcacctaagagtaaatctattgatgaggat
tctacagtaacgtttgtcgtatcattaggaaaagatgatggtaaagatgaagataaagct
gacgacaatccatcagtcaaagatgtgacacaaacggttcaagtgccatattctggtgaa
gataaagaacgtcagaaagtagaagtctttgtcagagataaagaccatgacggttcttca
gcagttcaaacgtttcatatcaacagcaatcgttcgatttcaatcccattaaaaattgaa
aaaggcaaaactgcttgttataccgtacgtgtagatgataaaatagtcgcagataaagac
gtcgcatatgactaa

DBGET integrated database retrieval system