KEGG   Staphylococcus simulans: AL483_08720Help
Entry
AL483_08720       CDS       T04303                                 

Gene name
hxlA
Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00030  Pentose phosphate pathway
ssif00680  Methane metabolism
ssif01100  Metabolic pathways
ssif01120  Microbial metabolism in diverse environments
ssif01200  Carbon metabolism
ssif01230  Biosynthesis of amino acids
Module
ssif_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
ssif_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AL483_08720 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    AL483_08720 (hxlA)
Enzymes [BR:ssif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     AL483_08720 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim HMGL-like PcrB PRAI DJ-1_PfpI ThiG
Motif
Other DBs
NCBI-ProteinID: AMG96908
UniProt: A0A133QUR4
LinkDB All DBs
Position
1778275..1778907
Genome map
AA seq 210 aa AA seqDB search
MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVQYMDENIDGVKVLADM
KIMDAADYEVSQAVKFGADVVTILGVAEDASIKAAVEEAHKNDKQLLVDMIAVQDIKQRA
KELDEMGADYIAVHIGYDLQAEGKSPLDDLHTVKSVIKNSKVAVAGGIKPDTIKDIVAEE
PDLVIVGGGIANADDPVEAAKACRDAVEGK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
ttggaactacaattagcaattgatttattaaataaagaagacgctgcagagttagctaac
aaagtgaaagattatgtcgatatcgtagaaatcggtactcctatcatatataacgaaggt
ctgcctgccgttcaatatatggatgaaaacatcgatggtgttaaagttctagcagatatg
aaaattatggacgctgcagactatgaagtcagccaagcagttaaattcggtgctgacgtt
gtaacaatcttaggtgttgctgaagacgcttctatcaaagctgctgtcgaagaagcacac
aaaaatgacaaacaattattagtagatatgattgctgttcaagacattaaacaacgcgct
aaagaattagatgaaatgggtgctgattatatcgcagtacacattggttatgacttacaa
gctgaaggtaaatctccattagatgatttacacacagttaaatctgttatcaaaaattct
aaagttgccgttgctggcggtatcaaaccagatacaatcaaagatatcgtagctgaagaa
ccagacttagtgattgttggtggcggtatcgcaaatgccgacgacccagtagaagcagca
aaagcttgccgcgacgcagttgaagggaaataa

DBGET integrated database retrieval system