KEGG   Staphylococcus simulans: AL483_09100Help
Entry
AL483_09100       CDS       T04303                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00790  Folate biosynthesis
ssif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AL483_09100 (folP)
Enzymes [BR:ssif01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AL483_09100 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AMG96965
UniProt: A0A2X3SH53
LinkDB All DBs
Position
complement(1848520..1849305)
Genome map
AA seq 261 aa AA seqDB search
MAHTKIMGILNVTPDSFSDGGKYNSVDAAVARVKEMMDEGVDIVDIGGVSTRPGHSEVLL
EDELERVIPVVKALSEFNVQLSVDTFRSEVAKAALEAGATMINDQWAGLYDPKMFEVVAQ
YDAEIVLMHNGDGQREDPVMDEMLVYLLKQAHRAETAGVATNKIWIDPGIGFAKTRLEER
EVMERLDELVATEYPVLLATSRKRFIKEMMGSDEGPEDRDEMTAATTAYGVMKGVQAVRV
HNVKLNARIAHGIDYLKEIER
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacatacaaaaatcatgggcatattgaatgtaacacctgattcattttctgacggc
ggcaaatacaattctgtagatgcggcggttgcacgtgtgaaggaaatgatggatgaaggt
gtcgacattgtagatatcggcggtgtttccacaagaccagggcacagtgaagtgttatta
gaagatgaattagaacgcgtcattccagttgttaaagcactctccgaatttaatgtgcaa
ttgtctgtcgacacgtttcgcagtgaagttgcgaaagcagcattagaggctggtgcaaca
atgattaatgaccaatgggcaggtttatatgaccctaaaatgtttgaagtcgttgcacaa
tacgatgctgaaattgtcttgatgcacaatggagatggacaacgtgaagatcctgtcatg
gatgaaatgctagtttatttattaaaacaagcacatcgtgcagaaacagcaggggttgcg
acgaataaaatctggattgatccaggtatcggctttgcgaaaacgagattggaagaacga
gaagttatggagcgactggatgaattagttgcgacagaatatccagtattgcttgcgacg
agtcgtaaacgcttcatcaaagaaatgatgggttcagacgaaggaccagaagatcgtgat
gaaatgacagcagcaacgactgcttatggtgtgatgaaaggtgtgcaagcggtacgtgta
cataatgtaaaactcaatgcgcgtattgcacatggcattgattatttaaaggagattgaa
cgatga

DBGET integrated database retrieval system