KEGG   Staphylococcus simulans: AL483_09690Help
Entry
AL483_09690       CDS       T04303                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssif  Staphylococcus simulans
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL483_09690
Enzymes [BR:ssif01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AL483_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored NAD_binding_7 K_oxygenase NAD_binding_8 DAO NAD_binding_9 Thi4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AMG97069
LinkDB All DBs
Position
1973492..1975015
Genome map
AA seq 507 aa AA seqDB search
MLDKELKSQLSQLLELMEGDVVLTASYDDSDKSKELKDLLDEIADMSSHITVKEDTLKRT
PSFSVDTPDAHTGIVFAGVPLGHEFNSLVLALLQVSGRPPKEEQSVIDQVKALEEPLHFE
TFISLSCQKCPDVVQALNMMSVLNPNITHTMIDGAVFREESEDIMAVPAVFLNGEEFGNG
RMTISDILNMLGSQADPAEFNGKEPFDVLVIGGGPASGTAAIYTARKGLRTGIVADRIGG
QVTETAGIENFITVKETTGPEFSSALEQHINEYDIDVMDGIRASNVEKTEDGIVVTLEND
AKLKSKTVIIATGARFKNLNIPGEDELRNKGVAYCPHCDGPLFEGKNVAVVGGGNSGAEA
AIDLAGIVKHVTLVEYKDFLRADEILQKRLGELSNVTILKNAQSSEVLGDDHVTGLKYED
NKTGETHQIDVDGIFVQIGLLPNSEWLHGAIDTNDHGEIIVDRKQETSMPGVFAAGDVTD
DRFKQIIIAMGTGADAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaagagttaaaatcacaattatctcaacttcttgaattaatggaaggcgac
gtggttttaacagcgagctatgatgacagcgacaaatctaaagagttgaaagacctgtta
gatgaaattgctgatatgtcatcgcatatcactgttaaagaggatacactgaaacgtaca
ccaagtttcagtgtagatactcctgatgcgcacacaggcatagtatttgccggtgtgcca
ttaggtcatgaattcaactcactcgtattggctttattacaagtcagcggacgccctccg
aaagaagaacaaagtgttatcgatcaagtcaaagcgcttgaagaaccgcttcatttcgaa
acatttatcagcctaagctgtcaaaaatgtccggatgtggttcaagcattgaacatgatg
agtgtgttaaaccctaacatcacgcatacaatgattgatggcgcagtcttcagagaagaa
tctgaagatattatggcagttcctgctgtattcttaaacggtgaagaattcggtaacggc
cgcatgactatttctgacatcttaaacatgttaggcagccaagcagaccctgctgaattc
aatggtaaagaaccattcgatgtattagtcatcggtggcggtcctgcaagtggtacagct
gctatctatactgcacgtaaaggtttacgtacaggtattgtggcagatcgtatcggtggt
caagtgactgaaactgcaggtatcgaaaactttatcacagttaaagaaacaacaggtcca
gaattctcatctgctttagagcaacacatcaatgaatacgatattgatgtgatggatggt
atccgtgcttctaacgttgagaaaactgaagacggcattgttgttactttagaaaatgat
gccaaactaaaaagtaagacagttattattgctacaggtgcacgcttcaaaaacttgaac
attccaggtgaagacgagttacgcaacaaaggtgttgcatactgccctcactgtgacgga
cctttattcgaaggtaaaaatgttgcggttgtcggcggcggcaactctggtgctgaagct
gctattgacttagcaggtattgtaaaacacgttacacttgtagaatacaaagacttctta
cgtgcagatgagattttacaaaaacgtttaggtgaattatcaaacgttacaatcttgaaa
aatgcacagtcttcagaagttcttggtgacgatcatgttaccggtcttaaatatgaagac
aacaaaactggcgaaacacatcaaattgatgtagatggtattttcgtccaaatcggtcta
ttaccaaactctgaatggttgcacggtgcaattgacacaaacgaccatggcgaaattatc
gtagaccgtaaacaagaaacaagtatgccgggtgtattcgcggcaggcgacgtaacagac
gatcgcttcaaacaaattatcatcgcaatgggtacaggtgcagacgctgcactgaacgca
tttgattatattatccgtaactaa

DBGET integrated database retrieval system