KEGG   Solibacillus silvestris DSM 12223: SOLI23_06025Help
Entry
SOLI23_06025      CDS       T04506                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ssil  Solibacillus silvestris DSM 12223
Pathway
ssil00010  Glycolysis / Gluconeogenesis
ssil00071  Fatty acid degradation
ssil00280  Valine, leucine and isoleucine degradation
ssil00310  Lysine degradation
ssil00330  Arginine and proline metabolism
ssil00340  Histidine metabolism
ssil00380  Tryptophan metabolism
ssil00410  beta-Alanine metabolism
ssil00561  Glycerolipid metabolism
ssil00620  Pyruvate metabolism
ssil00625  Chloroalkane and chloroalkene degradation
ssil01100  Metabolic pathways
ssil01110  Biosynthesis of secondary metabolites
ssil01120  Microbial metabolism in diverse environments
ssil01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOLI23_06025
   00053 Ascorbate and aldarate metabolism
    SOLI23_06025
   00620 Pyruvate metabolism
    SOLI23_06025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SOLI23_06025
   00561 Glycerolipid metabolism
    SOLI23_06025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SOLI23_06025
   00310 Lysine degradation
    SOLI23_06025
   00330 Arginine and proline metabolism
    SOLI23_06025
   00340 Histidine metabolism
    SOLI23_06025
   00380 Tryptophan metabolism
    SOLI23_06025
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SOLI23_06025
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SOLI23_06025
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SOLI23_06025
Enzymes [BR:ssil01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SOLI23_06025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1104 Hormone_recep
Motif
Other DBs
NCBI-ProteinID: AMO85157
LinkDB All DBs
Position
1269137..1270564
Genome map
AA seq 475 aa AA seqDB search
MLNHTKQYINGEWVNSTGTDTIEVINPATEEVVGKISSGTEEDVNRAVQAAKEAFPAFSK
MSVDDRIKLLEAIAEEYEKRKDDLVNIMTAELGAPITKSEEIHYKMGLSHFKQAAEQLKT
FKFTEEREKSYIQKEPIGVAGLITPWNFPTNQISTKLASALAAGCTMVVKPASQTPFVAV
ILAEILDKAGVPKGVFNLVNGSGSTVGEAISSHPDVDIVSFTGSGEVGSGLMKNAAEGIK
NISLELGGKSPYVILEDADVKEAAKTALAQIAMNTGQVCSAATRMIVPEEMHDKFIEAMK
ELVTEFPVGDPQDKNTFMGPQVSKDQWETVQSYIKKGEEEGAKIVIGGPGRPDGIDKGFF
SQITVFTNVKNDMTIAQEEIFGPVMSVITYKDLDEAIDIANDTIYGLAGYVFGNDKEKLK
KVALSIRAGQIRINNSETDRSAPFGGFKHSGIGREWGDYGIEEFLEPKAIMGMPL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatcatacaaaacagtacatcaatggggaatgggttaattctactggaacagat
actattgaagttattaatccggcgacagaagaagtagttgggaagattagcagtggaact
gaagaagatgtgaatcgagcggtccaggcagcgaaggaggcgttcccggcattttctaaa
atgtcagtggacgaccgtataaagcttttagaggcaattgctgaggaatatgaaaaacgt
aaagacgatttagtaaatataatgaccgctgaactaggtgcgcctattacaaagtcggag
gaaatccactataagatggggctttcacactttaaacaggcggcagaacagttaaaaacc
tttaagtttacggaagaacgagagaaatcctatattcaaaaagaaccgattggtgtagca
gggctgatcacaccgtggaatttccctacaaatcagatttccactaaacttgccagtgca
ttggcagcaggatgtacgatggttgtgaaacctgcttcccaaacaccatttgtagcagta
attctggcggaaattttggataaagccggtgtaccaaaaggcgtatttaatcttgtcaat
ggttcgggttcaacagttggtgaggcaattagttctcatcccgatgtggatattgtatcg
tttacaggatctggagaagtaggtagcggtttaatgaaaaatgctgcagaaggtattaaa
aatatctccttggaacttggaggcaaatcgccttacgttattttagaagatgcggatgta
aaagaagcagcaaaaacggcattggctcaaattgctatgaatacagggcaagtatgttcc
gctgctacacgcatgattgtaccggaagaaatgcatgataagttcatagaggcaatgaaa
gaattagtaacagaattcccagttggcgatccgcaggacaaaaacacatttatgggtccg
caagtttcaaaagaccaatgggaaacggttcagtcctatattaaaaaaggtgaagaagaa
ggcgcaaaaattgtaatcggcggccctggcagacccgatggaattgataaaggattcttc
tcccaaataaccgttttcacaaatgtgaaaaatgatatgacaattgcacaagaggaaatt
tttggtccggttatgtcggttatcacttataaagatttagacgaagcaattgatattgcc
aacgatacgatttatggtcttgccggttatgtattcggaaatgataaagaaaaactgaag
aaagtcgctttatcaatccgagcgggacaaatccgtattaataatagtgaaacggatcga
tcggcaccatttggcggattcaaacattctggtattggccgtgaatggggcgattatgga
atcgaagaatttctcgagccaaaagcgattatgggaatgccgttataa

DBGET integrated database retrieval system