KEGG   Solibacillus silvestris DSM 12223: SOLI23_10705Help
Entry
SOLI23_10705      CDS       T04506                                 

Definition
(GenBank) glutamine amidotransferase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
ssil  Solibacillus silvestris DSM 12223
Pathway
ssil00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssil01100  Metabolic pathways
ssil01110  Biosynthesis of secondary metabolites
ssil01130  Biosynthesis of antibiotics
ssil01230  Biosynthesis of amino acids
ssil02024  Quorum sensing
Module
ssil_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SOLI23_10705
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SOLI23_10705
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SOLI23_10705
Enzymes [BR:ssil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SOLI23_10705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AMO86042
LinkDB All DBs
Position
complement(2170124..2170705)
Genome map
AA seq 193 aa AA seqDB search
MILLIDNYDSFTYNLYHQIAQFGEDIKIIRNDAITVEEIRALQPKAIVISPGPGEPRDAG
IVIEMIRDLYKEIPILGICLGHQSIGEAFGATVSRAKNIMHGKTSLLQFEKTGLFAQFER
EVEVMRYHSLIIEKQTLHEDFRIVATSADDGEIMAIQHKQYPVYGLQFHPESIGTELGKD
MISMFLKKVEVLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattttactgattgataattacgattcatttacgtataatctgtatcaccaaattgca
cagtttggagaagacataaaaattattcgaaatgatgccatcacggttgaggaaatccgc
gcattgcagccgaaagcaatagttatttctccaggacccggggaaccgagagacgcaggg
attgtcattgaaatgatccgcgatctttacaaagagattccgatattgggaatctgcctc
ggccatcaatcgattggcgaagcgtttggtgcaacggtgagccgtgccaaaaatattatg
catgggaaaacgagcctgctgcagtttgaaaaaacgggtttgtttgcacaatttgaacga
gaagtagaagtgatgcgatatcattcgctaatcattgaaaaacaaacattgcacgaagat
ttccgcattgtcgctacaagcgcagatgatggggaaataatggccattcaacataagcaa
tatccggtatatggactgcaattccaccctgagtcaatcggaacagaacttggtaaggat
atgattagcatgttcttaaagaaggtagaagtattagcatga

DBGET integrated database retrieval system