KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0338Help
Entry
SSUD12_0338       CDS       T02021                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00220  Arginine biosynthesis
ssk00250  Alanine, aspartate and glutamate metabolism
ssk00290  Valine, leucine and isoleucine biosynthesis
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01130  Biosynthesis of antibiotics
ssk01210  2-Oxocarboxylic acid metabolism
ssk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSUD12_0338
   00290 Valine, leucine and isoleucine biosynthesis
    SSUD12_0338
   00220 Arginine biosynthesis
    SSUD12_0338
Enzymes [BR:ssk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SSUD12_0338
    2.6.1.66  valine---pyruvate transaminase
     SSUD12_0338
Amino acid related enzymes [BR:ssk01007]
 Aminotransferase (transaminase)
  Class I
   SSUD12_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AER18671
UniProt: G7SF30
LinkDB All DBs
Position
352965..354179
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEAAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILEGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVEDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgacattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtattggtgccaatgccagactatcctctctggactgccgcagttagtttggctggt
ggtaaagctgttcactatgtttgtgatgaagcagctgaatggtatccagatttggcagac
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttagaaggaatcattgacattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgacggagctgttcat
atccctattgcgacactggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcgcatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgagctcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccgggactttctgctgtaaaacctaaggctggtctgtatgtcttccccaaaattgatcgt
gagatgtaccgagttgaggatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgtggatgagttggcagaaattcaagaaaaaatgtcacgattcttgcgg
caatatcgtagataa

DBGET integrated database retrieval system