KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0519Help
Entry
SSUD12_0519       CDS       T02021                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00620  Pyruvate metabolism
ssk00680  Methane metabolism
ssk01100  Metabolic pathways
ssk01120  Microbial metabolism in diverse environments
ssk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUD12_0519
  Energy metabolism
   00680 Methane metabolism
    SSUD12_0519
Enzymes [BR:ssk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SSUD12_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RasGEF
Motif
Other DBs
NCBI-ProteinID: AER18842
UniProt: G7SFD4
LinkDB All DBs
Position
520356..523052
Genome map
AA seq 898 aa AA seqDB search
MAIQKLENYNNKEAIREEVTILTSILEEVAAQMMPAETFAKIVELSQLSRQDDYQALIAI
ISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQDYLGKISTTIDMVSKQE
NAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRDVKLGLLNKNKWEDELRC
YIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVTKLQREYKRLAAEKGIVLNNPRP
ITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDEQLYKLYRNFSLSTSIVNVSTA
VKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVHNKPSDVRYSNVAEFKADLLA
IKQSLIENKSMALLKGDFTELLEAVEAFGFYLASIDMRQDSSIHEASVAELLASARIVED
YSSLSEEAKCHVLLKQLETDPRILSATHIPKSEQLEKELAIFAAARELKDKLGEEIIKQH
IISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLFETIEDLDNAPDTMRQYLQLDLAK
RWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQNELTQIGQDYGVNITFFHGRGGTV
GRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTQ
MITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNPHFYDYFFAASPIREVSSLNIGSRPAA
RKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVGSSFKRFIDKHPDNLSKLQKMYESWPFF
RSLLSNVDMVLSKSNMNIAFEYAKMCESEEVRNIFHVILDEWQLTKEIILSIEQNDELLA
ELPFLKASLDYRMPYFNVLNYIQIELIHRLRRGELSKEQENLIHITINGVATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaaaaattagaaaactataacaacaaggaagcaatccgtgaagaagtaacg
attctaacatctattttggaagaagtagcagcccaaatgatgcctgcagagacttttgct
aaaattgtagaattatctcaattgtctcgtcaagatgattatcaggcattgattgctatt
atcagtcagttgaataatgatgaactagcagttatttctcgatactttgctgttttgcca
cttttgattaatatatcagaagatgttgatttggcctatgaaatcaaccatcaaaacaat
attgatcaagattatcttggtaagatttcaacaacaattgatatggtttccaaacaagaa
aatgcagctgaaatccttgaaaagttgaatgttgttccagtcttgacagcccatcctact
caggttcaacgccagtctatgcttgatttaaccaagcatattcatgagttgcttcgtcgt
tatcgcgatgtaaaattgggcttgctcaataaaaacaaatgggaagatgagctccgttgt
tacattgaaattatcatgcagacggatatgattcgtgagaagaagttgaaggtaaccaac
gaaatcacaaacgttatggagtattacaattcttcctttattaaggctgtcactaagttg
cagcgggaatacaaacgtttggctgctgagaaaggaatcgtcttaaataatcctcgtcca
attacaatgggcatgtggattgggggagaccgtgatggaaatccatttgttactgcagag
accttgaagctgtcagccttgactcagtgtgaagtcattatgaattattacgatgagcaa
ctctataaactctatcggaatttttcgctctcaacttccattgtaaatgtatctacagcg
gttaagatgctggcggatttatctgaagatagttctgtctaccgtgaaaatgagccttat
cgtcgtgcttttcactatattcagatgaaacttgcaaatacaagagattatctagttcac
aataagccgtcagatgttcgctatagtaatgtagccgagtttaaagctgatttattagcc
atcaaacaatctttgattgaaaataaatcaatggcgctattgaaaggtgattttacagaa
ttgcttgaagcggttgaagcgtttggtttctacctagctagtatcgatatgcgccaagac
tcttctattcatgaagcaagtgttgcggagctattggcttctgcccgtatcgtagaagac
tactccagtttatctgaggaagctaaatgccatgttcttttgaaacagttggaaacagat
ccacgcattctttctgcgacgcacataccaaagtcagaacaattagaaaaagaattggct
atctttgctgctgcgcgtgaattgaaagataagctaggtgaggaaatcatcaagcaacat
attatttcacactcggagagtgtttctgatttgctggaattagctgtcctattaaaagaa
gttggtctagtagatgtcgataaggcccgtgttcagattgttccactttttgagacaatc
gaggacttagataatgcacctgataccatgcgtcaatatctgcaattagatttagcgaaa
cgttggattgcaggcaataaatactaccaagaaatcatgcttggctactcagattccaac
aaggatggtggctacctatcctccggttggacactctacaaagcacagaatgaattgacg
caaattggtcaagactacggagtaaacatcaccttcttccacggtcgtggtggtactgtt
ggtcgtggtggtggtccgtcctacgatgcgattacatctcagccatttggttctatcaag
gaccggcttcgtttgacagaacaaggcgaagtgataggcaataaatatggtaacaaagac
gcagcctactataatttagaaatgctggtatctgcaacgcttgaccgtatggtcacacaa
atgattaccgatccaaatgaaatcgatggctatcgcgaaactatggatgaaattgtatca
gatagctatcgtatttatagagatcttgtgttcaacaatccacatttttatgattatttc
tttgccgctagtccaattcgtgaagtatcaagtctgaacattggctcacgtcccgcggct
cgaaaaaccatcacagaaatcggtggtttgcgtgcgattccatgggtattctcctggtca
caaaaccgtgttatgttgccagggtggtatggagttggttcaagtttcaaacgctttatt
gataagcaccctgataatttgtctaagttacaaaaaatgtacgaatcttggccattcttc
cgttcacttctatcaaacgtggatatggtattgtctaaatccaatatgaatatcgcattt
gaatatgctaaaatgtgtgaaagcgaagaggtacgaaatatcttccatgtcattttagat
gaatggcagttgaccaaagaaattattttgtcaatcgagcaaaatgatgagcttttagca
gaactaccgtttctaaaagctagtcttgattatcgcatgccttatttcaatgtgctcaac
tatattcagattgaattaattcatcgtcttcgtcgtggagaattgagcaaagaacaagag
aatctcattcatattaccatcaatggtgtggcgacaggtttgcgcaactcaggttaa

DBGET integrated database retrieval system