KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0601Help
Entry
SSUD12_0601       CDS       T02021                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00473  D-Alanine metabolism
ssk00550  Peptidoglycan biosynthesis
ssk01100  Metabolic pathways
ssk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSUD12_0601 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUD12_0601 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SSUD12_0601 (ddlA)
Enzymes [BR:ssk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSUD12_0601 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ssk01011]
 Precursor biosynthesis
  Amino acid ligase
   SSUD12_0601 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AER18922
UniProt: G7SGQ7
LinkDB All DBs
Position
611155..612201
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFISQTGDFIKTQEFSQTPA
ADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAEIEGKLTYPVFVKPANMGSSV
GISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEVGLLGNADVKTTLPGEVVKDVAF
YDYDAKYIDNKITMEIPAKIDESIMDTMRDNAAKAFRAIGGCGLSRCDFFLTEDGDIFLN
ELNTMPGFTQWSMYPLLWDNMGLAYPDLIEELVRLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaccttgattttactatatggtgggcgttctgcagagcgtgaggtatct
gttctgtctgccgaaagcgtcatgcgtgctatcaattatgataaattttttgtcaaaacc
tatttcattagccagacaggggactttattaagacgcaagagttttctcaaactccagct
gctgatgaaaaactcatgacaaacgcgacgattgttgaagagcaaaaaatccgtccgagc
gatatttatgaagaaaaggcagttgttttccctgttcttcatggcccaatgggagaagac
ggatctattcaaggcttcttggaagtgcttcgtatgccttatgttggcactaatatcttg
tcttcaagcgttgctatggacaaaatcactaccaagcgcgtacttgaatcagcaggaatc
tcccaagtaccttatgtggcagttatcgaaggtgaaaatatcgacgataagattgcagag
attgaaggaaaattgacttatccggtctttgtaaaaccagctaatatggggtcaagtgtc
ggtatctcaaaagctgaggatttagctggcttgcgtaaggcacttgatctggccttcaag
tatgacagccgtgtcctcgttgagcagggtgtcaatgcgcgtgagattgaggtcggtctt
ttgggaaatgctgacgtgaaaacgacccttcctggcgaagtagtcaaagacgttgccttt
tatgactacgatgccaaatacatcgacaacaaaatcaccatggaaatcccagctaagatt
gatgagtctatcatggacaccatgcgggacaatgctgccaaggccttccgtgctatcggt
ggttgtggtctttctcgctgtgatttcttcctgacagaagacggagacattttcctcaac
gaactcaataccatgccaggctttacccagtggtctatgtatccactcctttgggataat
atgggcctagcttatccagacttgattgaagagcttgttcgtttggctaaggaaatgttt
gaaaaacgcgaaagtcacctcatttaa

DBGET integrated database retrieval system