KEGG   Sclerotinia sclerotiorum: SS1G_00053Help
Entry
SS1G_00053        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
ssl  Sclerotinia sclerotiorum
Brite
Translation factors [BR:ssl03012]
 Eukaryotic Type
  Elongation factors
   SS1G_00053
 Prokaryotic Type
   SS1G_00053
Mitochondrial biogenesis [BR:ssl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SS1G_00053
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SS1G_00053
  Exosomal proteins of breast cancer cells
   SS1G_00053
  Exosomal proteins of colorectal cancer cells
   SS1G_00053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 5494478
NCBI-ProteinID: XP_001597967
UniProt: A7E431 A0A1D9Q105
LinkDB All DBs
Position
Unknown
AA seq 447 aa AA seqDB search
MPAFARSVTPFFQTARSALRQGNAVSPLQHALRRQNGAAVINAARSYATAFERSKPHVNI
GTIGHVDHGKTTLTAAITKRQAEKGMANFLEYGAIDKAPEERKRGITISTAHIEYATEAR
HYSHVDCPGHADYIKNMITGAANMDGAVIVVAASDGQMPQTREHLLLARQVGVQKIVVFV
NKVDALEDPEMLELVEMEMRDLLTTYGFEGEETPIILGSALCALEGRRPELGTEKIDELM
NAVDTWIPTPQRDLDKPFLMSVEDVFSIPGRGTVASGRVERGILKKDSEVEIVGKGDQVI
KTKVTDIETFKKSCDESRAGDNSGLLLRGIKREDVRRGMIISAPGTTKAHTKFLVSMYVL
TKEEGGRHTGFHQNYRPQIFIRTADEAAALHWPEGTEDADSKMVMPGDNVEMQCEIEKPC
AMEVGQRFNIREGGRTVATGLVTRIIK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgtttgcgagatcagttactcctttcttccagaccgcacgatcggcgctgcgt
caaggtaatgctgtcagtcccttacagcatgctttgagaagacaaaatggagctgctgtg
atcaatgctgctcgttcatatgctaccgctttcgagcgttcgaaaccgcatgttaatatt
ggtacaattggtcacgtcgatcatggaaagactactttgacggccgccattaccaagaga
caagcagagaagggaatggctaatttcctcgagtacggtgccattgacaaggctcctgaa
gagcgaaagcgtggtatcaccatctccactgcccatattgaatatgctaccgaagctcgc
cactactcccacgttgattgtcccggtcacgcagattacattaagaacatgattaccgga
gctgcaaacatggatggagccgtcattgtcgttgctgcttccgatggacaaatgcctcaa
acccgtgagcatcttttactcgcccgtcaagttggtgttcaaaagattgtcgttttcgtc
aacaaggtcgatgctcttgaggaccctgagatgttggagttggtcgagatggagatgcgt
gatctcctcaccacatatggatttgagggagaggagacacctatcattcttggttccgcc
ctttgcgcactcgagggccgcagaccggaactcggaactgagaaaatcgatgaattgatg
aatgcagttgatacctggatcccaaccccacaacgtgatctcgacaagcctttcctcatg
tccgtcgaagatgttttctctattcccggtcgtggaactgttgcctccggtcgtgtcgag
cgcggtatcctcaagaaggattcagaagtcgaaattgtcggaaagggagaccaagttatc
aagacaaaggttactgatatcgagactttcaagaagtcttgcgacgaatcccgcgcagga
gacaactccggacttttgctccgtggtatcaagcgtgaagatgtccgacgtggaatgatc
atttccgccccaggaaccaccaaagcacacaccaaattcctcgtctcaatgtacgtcctc
accaaggaagaaggaggacgccacacggggttccaccaaaactaccgcccacaaatcttc
atccgaaccgccgacgaagccgctgccctccactggcccgagggaaccgaagacgccgac
tccaaaatggtcatgccaggtgacaacgtcgagatgcaatgcgagattgagaagccctgc
gccatggaagtcggtcaacgtttcaacatccgtgagggaggaagaaccgtcgccactgga
ttggttaccagaattatcaagtaa

DBGET integrated database retrieval system