KEGG   Sclerotinia sclerotiorum: SS1G_00795Help
Entry
SS1G_00795        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00250  Alanine, aspartate and glutamate metabolism
ssl00410  beta-Alanine metabolism
ssl00430  Taurine and hypotaurine metabolism
ssl00650  Butanoate metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
Module
ssl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SS1G_00795
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SS1G_00795
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SS1G_00795
   00430 Taurine and hypotaurine metabolism
    SS1G_00795
Enzymes [BR:ssl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SS1G_00795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC OKR_DC_1 MTCP1
Motif
Other DBs
NCBI-GeneID: 5494536
NCBI-ProteinID: XP_001598706
UniProt: A7E670
LinkDB All DBs
Position
Unknown
AA seq 579 aa AA seqDB search
MSREHCREEVLIAGCYCRFIQPIRELDFIHTVNELSFSAKILELPKTAGACIPGRGAEKA
PAIMVHLSQIPSEQNVTAPLVEGLKKLTMAASSEEDAFTTSVYGSKFAAQDLPRHEMPEG
EMPKEVAYRMIKDDLSLDGNPMLNLASFVTTYMEKEVEDLMTESFSKNFIDYEEYPQSAD
IQNRCVSMIGRLFNAPTNAEGDAAVGTSTVGSSEAIMLAVLAMKKRWKNARIAAGKSTNN
PNIVMSSAVQVCWEKAARYFEVEEKYVYCTPDRYVIDPEETVNLVDENTIGICVILGTTY
TGEYEDAKAVNDLLIKKNIDTVIHIDAASGGFVAPFVCPELEWDFRLEKVVSINTSGHKY
GLVYPGVGWIVWRAPEYLPKELVFNINYLGADQASFTLNFSKGASQVIAQYYQLIRLGKK
GYRSIMNNLTRTADYLSDSLQQLGFIIMSQKNGRGLPLVAFRIDPESDKHYDEFAIAHQL
RQRGWVVPAYTMAPKTENLKMLRVVVREDFSKSRCDQLLNDIKLCCSVLNEMDKETIKKN
QEYIKMHSTHVGKSKHNHPHYKNEKHSLQGKTGKTHAIC
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggagcattgtagggaggaagtcttgattgctggatgttactgtagatttatt
caaccaattagagagttggatttcatacatactgtcaacgagctaagcttttctgccaag
attctcgagcttccaaaaacagctggagcttgtatccctggaagaggggcagaaaaagct
cccgcaatcatggttcacttgtctcaaatccccagcgagcaaaatgtgactgctcctctc
gttgagggcctcaaaaaacttacaatggctgcttcgagcgaggaggatgccttcactact
agcgtctatggttctaaatttgccgctcaggatcttcctcgacatgaaatgccagagggt
gaaatgccaaaagaggttgcgtatcgtatgattaaggatgatttatctcttgatggaaac
cctatgcttaacttggcttcttttgttactacgtatatggagaaagaagtagaagatctc
atgacagagagtttcagcaaaaactttatagactacgaagaataccctcaaagtgccgat
atccaaaaccgatgtgtatccatgattggccgtctattcaacgctcctacaaatgcagaa
ggtgatgccgctgtgggaacttcgaccgtcggttcctccgaagctatcatgttggcagtt
ttggccatgaagaaacgttggaagaatgctcggattgccgccggaaaatcaacaaataat
cctaatattgttatgtcctctgctgttcaggtctgttgggaaaaggcagcgagatatttt
gaggttgaggagaaatatgtttactgtactccggatagatatgttatcgatccagaggag
acagttaatttggtggatgagaatactattggtatatgtgtcatcttgggaactacttat
actggagagtatgaggatgctaaagctgtcaatgatcttttgatcaagaagaacattgat
actgtcattcacatcgatgctgcgtctggtggattcgtggcaccattcgtttgtcctgaa
ttggagtgggatttcagattagaaaaggttgtttctatcaacactagtggtcacaagtat
ggattagtctatccaggtgttggctggattgtctggagagcaccagaataccttccaaag
gagctagtcttcaacatcaattaccttggtgctgatcaagcttccttcactcttaacttt
tccaagggtgcttcgcaagttattgctcaatattatcaactcattcgtcttggtaagaaa
ggttaccgttctatcatgaacaatttgacaagaaccgccgactacctctccgattctctt
cagcaactcggattcatcatcatgtctcaaaagaacggcagaggtctcccactcgttgcc
ttccgcatcgaccctgaatccgacaaacattacgatgaattcgcaattgctcatcaactt
cgtcaacgtggatgggttgttccagcatataccatggcacccaagaccgaaaatctcaag
atgttacgtgtagttgtccgtgaggatttcagcaaatctagatgcgatcagttattgaat
gacattaaactgtgctgcagtgtcttgaatgagatggacaaggaaacaattaagaagaat
caagaatatattaagatgcattctactcatgttggaaagagcaagcataatcatcctcat
tacaaaaatgagaagcacagcttgcaggggaagaccggaaagactcatgctatttgttaa

DBGET integrated database retrieval system