KEGG   Sclerotinia sclerotiorum: SS1G_01083Help
Entry
SS1G_01083        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00052  Galactose metabolism
ssl00500  Starch and sucrose metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SS1G_01083
   00500 Starch and sucrose metabolism
    SS1G_01083
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SS1G_01083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 5494096
NCBI-ProteinID: XP_001596891
UniProt: A0A1D9PUH9 A7E707
LinkDB All DBs
Position
Unknown
AA seq 998 aa AA seqDB search
MRGKLGVTVAAFATAFLNTTLAQDSTSSQADADTTTSYCPVYTLTASVDASAPIIPNIHD
PQAINPQDVCPGYTASNVKRTSHGLTASLSLAGDACNVYGTDIDSLNLTVEYQSKDRLHV
GIVPTYVGPSNSSWFILPESLVEKPSIDADADSTTLDSDLSFLWSNGPTFSFSIFRQSTG
DVLFSTVGTKLVYENQFIEFASSLPENYNLYGLGESIHGFRMGNNYTRTFWAADVGDNID
ANIYGDHGIYLDTRYYEVDPGTGNMTYVSNVTNATEDYVSYTHGVYQRNAHGQEVLMKPS
NITWRTLGGSIDLYFYAGPTQEKVTKAYQMSAVGLPAMQQYFTFGYHQCRWGYSNWTELG
EVVDNFAKFGLPLETIWLDIDYMNQYRDFEVDERRFGHFEGAEFLSKLHGNGQHIVPIVD
SAIYIPNPENATDAYPPFSRGNETGSFMLNPDGSLYVGSVWPGYTVFPDWIGSVLNGTGA
HKWWIDELTTWHSNFSFDGIWIDMSEVSSFCVGSCGSNNLTLNPVHPPFLLPGEPGNVDF
NYPEGFNLTNSTEAASASSASASQSSAYATSTATTSSSTTYIRTTPTPGSRDIVYPPYAI
NNFQGSLDVHAVSPNATHHGGTQEYDYHNLFGTQILNATYNALRNVFPTKRPFIIGRSTF
AGSGKWAGHWGGDNYSLWAYMFFSIPQALSFSLFGIPMFGADTCGFSGNSDEELCNRWMQ
LSAFFPFYRNHNTLAANPQEPYVWASVIDATKAATTIRYTLLPYIYTTFYLAHSTGSTVM
RALAWEFPNDPTLASADRQFLLGPNILVTPVLEQGATSVDGVFPGSGKGQVWYDWYNQSA
ITSSPGQNITIDAPLGHIPVYIRGGAILPIQEPALTTRECRKNPWGLLVASNLEGMASGE
LYLDDGESVVPNATLWVDFSMTQNSLYASGRGSYVDSNSLANITILGVSSPVTNVDWNGA
SLTSGWTYNSTSQVLAVKGLSNSTSDGAWTSDWVLKWA
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcaagcttggtgtcacagttgctgcatttgcgacggcatttctaaatacgaca
cttgctcaagactcaacatcatcacaagcggatgcggatactaccacaagttattgtccc
gtttacacgctcacagcttcagttgatgccagcgcacctattatcccaaacatccacgat
ccgcaggcaattaatccacaagatgtttgtccggggtatactgcatccaatgtgaagcga
acctctcacggattgacggcttctctgtcattggctggtgatgcttgcaatgtttatgga
acggatatagattccctcaatctgacagtggagtaccaatcgaaagatcgtcttcatgtg
gggattgtccctacttatgttggaccttcaaacagctcctggtttatcctcccagagtca
cttgttgagaaaccttctattgatgccgatgcggactctaccaccctggatagtgatctt
agctttttatggagtaatggtccgacattctcgttctcgatatttcgtcaatctacaggg
gatgttcttttctccaccgtgggtactaaattggtttacgagaaccaatttatcgagttt
gctagttctttgccagagaactacaatctttatggattaggggagtcaatccatgggttt
cgtatgggtaataactatacacgaactttctgggccgccgacgttggtgataacatcgat
gcgaatatttatggcgatcatggaatatatctcgatacaagatattacgaggttgatcca
ggtacgggaaacatgacctatgtctcaaatgtgacgaatgccaccgaagattatgtttct
tacactcatggtgtctatcaacgaaatgctcatggccaagaagtcttgatgaaaccatca
aacatcacgtggaggacacttggtgggagtattgatctgtacttctatgctggtccaaca
caagagaaagttacaaaggcatatcagatgagtgctgttgggcttccagctatgcaacaa
tactttacattcggatatcaccaatgtcgatggggctactcgaactggactgaactgggc
gaggttgttgacaatttcgcaaaatttggtcttccattagagaccatttggttggatatt
gattacatgaatcaataccgcgactttgaggttgacgaacgcaggtttgggcattttgaa
ggagctgaatttctctcaaagcttcacggaaatggacagcatattgttccaattgtggac
tctgcaatttacattcctaatcccgaaaacgcaacagatgcgtatccacctttcagtcgt
ggtaatgaaaccggcagttttatgctgaatcctgatggtagtttgtatgtaggaagtgta
tggcccggttacacggttttccctgattggattgggtccgtgttgaatggcacaggagca
cacaaatggtggatagacgaacttacaacatggcattcaaatttttccttcgatggcatt
tggattgacatgagtgaagtttcttctttctgtgttggctcgtgcggaagcaacaatctc
actctcaatcccgttcatccaccatttctcctaccaggcgaaccaggaaatgtcgatttc
aactacccggaagggtttaatctcactaattctactgaagcggcatctgcatcttctgcc
tctgccagtcaatcctcagcttatgctacctcaacagcaacaacatcatcttccacgact
tatatccgcacaacaccaacaccgggttcccgcgatatagtttatcctccatacgccatt
aacaatttccaaggatcattggatgtccatgcagtgtcaccaaatgcaacgcatcatggt
gggactcaagaatatgactatcataatctattcggaacccaaattttaaacgccacgtat
aacgccctccgcaatgtcttcccaactaaacgtccatttatcatcggccgttctactttt
gcagggtctggtaagtgggctggacattggggaggtgataattattctctatgggcctac
atgtttttctctatcccacaagccctatcgttttctttattcggaattcccatgttcgga
gcagatacttgtggcttctccggcaatagtgacgaagagctctgcaatcgctggatgcaa
ctctccgctttctttccattttaccgaaatcataatactttggctgccaatccacaagag
ccatacgtgtgggcatccgtcatcgatgccactaaggctgctactacgatcagatataca
cttctcccatatatctatactacgttctacttggcacattccaccggctcaaccgtgatg
cgggctcttgcctgggaattccccaatgatcccaccctagcttctgcagatcgacagttt
ctactcggcccaaacattctggtaacccctgtcttggagcaaggcgctacctccgtcgat
ggtgtattccctggatctggaaaggggcaggtctggtacgattggtataaccagtctgcg
attacctcatcccctggtcaaaacattacaattgacgcaccactcggtcatattccagtt
tatatccgtggtggtgccattcttccaattcaggagcctgcattgacgactcgagaatgc
agaaaaaatccttggggattgttggttgcatccaacttggaagggatggctagtggtgaa
ctgtatctggatgatggagaatctgtagttcctaatgctactctttgggttgatttctcg
atgacacaaaattcattatacgcatcaggacgaggtagttacgtcgatagtaactcgctt
gccaatattacaatcttgggtgtatcgtcacctgttaccaatgttgattggaatggtgct
agtctcaccagcgggtggacatataattctactagccaagtccttgctgtcaagggattg
agtaattctacgagtgatggagcttggacgagtgattgggtgttgaaatgggcttga

DBGET integrated database retrieval system