KEGG   Sclerotinia sclerotiorum: SS1G_01273Help
Entry
SS1G_01273        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00010  Glycolysis / Gluconeogenesis
ssl00051  Fructose and mannose metabolism
ssl00052  Galactose metabolism
ssl00500  Starch and sucrose metabolism
ssl00520  Amino sugar and nucleotide sugar metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_01273
   00051 Fructose and mannose metabolism
    SS1G_01273
   00052 Galactose metabolism
    SS1G_01273
   00500 Starch and sucrose metabolism
    SS1G_01273
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_01273
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SS1G_01273
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SS1G_01273
Membrane trafficking [BR:ssl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SS1G_01273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 5493651
NCBI-ProteinID: XP_001597079
UniProt: A7E7J5 A0A1D9PU66
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MVGLGPRKPPSRKGSMAEVPKNFLEQIKKLEQQFTVDTKKLKEITEHFVSELTKGLTVEG
GSIPMNPTWCMSFPDGYETGTFLALDMGGTNLRVCEIILTDEKSEFDIMQSKYRMPEELK
TGDADELWEYIADCLQQFIESHHQGEKLDKLSLGFTFSYPATQNYIDEGILQRWTKGFDI
EGVEGENVVPMFEAALAKRGVPIKLTALINDTTGTLIASAYTDTSMKIGCIFGTGCNAAY
MENCGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHDNKDIHIFEGQDIEKLRKAYTLDSSFLSLVEEDPFENLSET
ADLFQNKLGIVTTVPELELIRRLAELIGTRAARLSACGVAAIAKKKGYETCHVGADGSVF
NKYPHFKARGAAALREILDWPAKKSPKEHDPIEILAAEDGSGVGAALIAALTLKRVKEGN
MAGILHPENFR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtggggttaggtccaagaaagcctccttcccgtaagggttccatggcggaggttcca
aagaatttcttggagcaaatcaagaaacttgagcaacagttcaccgttgacaccaaaaag
ctcaaggagatcaccgaacatttcgtctctgagcttactaaaggtctcacggtggagggt
ggaagtattccaatgaacccaacatggtgtatgtctttcccagacggttatgaaacaggc
actttcctcgccttggacatgggaggtaccaacttgcgtgtctgtgagatcattttgacc
gatgagaagtctgagttcgatattatgcaatcaaagtatcgcatgcctgaagagctcaaa
actggtgatgccgatgagctttgggagtatattgcggattgtcttcagcagtttatcgag
tcccatcaccagggcgagaagcttgacaaattgagtcttggtttcaccttttcttaccca
gctacccagaactacattgatgagggtattttgcaaagatggaccaagggtttcgatatt
gaaggtgttgagggcgagaacgttgttccaatgttcgaagcagctcttgctaagagaggt
gtgccaattaagctcactgctttgatcaatgataccaccggtactttgatcgcttccgca
tacactgatacatccatgaagattggatgtatctttggaactggttgcaatgctgcttac
atggaaaattgtggctccattccaaaattggcccacatgaacctacctcctgacactcca
atggctatcaactgcgagtggggtgcttttgacaatgaacacaaagttctcccccgtact
ccatacgatatcattattgataaagattctccacgtcccggtcagcaagcatttgagaag
atgattgctggtctttaccttggagaacttttcagattggttctagttgatcttcacgac
aacaaagacattcacatctttgagggtcaggacatcgagaagctccgaaaagcttatacc
ttggactcttctttcttatccttggttgaggaggatccattcgagaacttgtccgagaca
gctgacctgttccaaaacaagctcggcatagtcaccactgttccagaacttgagcttatc
cgccgtctcgctgagttaatcggtacccgtgccgcccgtctttccgcctgtggtgttgcc
gccattgccaagaagaagggttatgagacctgccacgttggagctgatggatcagtcttc
aacaaataccctcacttcaaggctcgtggtgcggcagcacttcgtgaaattcttgattgg
cctgccaagaagagtcctaaggagcatgatcctattgaaatcttggccgccgaagatgga
tctggtgtcggtgcagctttgattgctgctttgaccctcaagcgtgttaaggaaggtaac
atggctggtatcttgcacccagagaacttcagatga

DBGET integrated database retrieval system