KEGG   Sclerotinia sclerotiorum: SS1G_01918Help
Entry
SS1G_01918        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SS1G_01918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssl02000]
    SS1G_01918
Enzymes [BR:ssl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SS1G_01918
Transporters [BR:ssl02000]
 Other Transporters
  Pores ion channels [TC:1]
   SS1G_01918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 5494153
NCBI-ProteinID: XP_001597722
UniProt: A0A1D9PSU1 A7E9D8
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MSQPITLYGHRGGPNPWKVAIILEELKVPYINKFMEMADLKKEPFETINPNGRVPAITDP
NTDVTLWESGAIIEYLIDTYDHTAALTYTSSPERYQVKQWLHFQMSGQGPYYGQAAWFTK
FHAEKIDSAIERYLEQIKRVLYVLDKHLNGKEWLVGDKCTFADLSFVPWDMAIPWIFGDR
VGELEIEKNYPHYFAWNKRLMERPSVQKIVKDKAAATSGH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaccaattactctctatggccacagaggcggcccaaacccatggaaggtggcc
attattcttgaggagctcaaggttccatatatcaacaagtttatggaaatggccgacctc
aaaaaagagcccttcgaaacaatcaaccccaacggccgcgtccccgccatcaccgaccca
aacaccgacgttacactttgggaatccggcgctataatcgaatatctaattgatacctac
gaccacaccgccgcactaacctacacctcatccccagagcgctaccaagtaaaacaatgg
ctgcacttccaaatgtccggccaaggtccctactacggacaagcagcttggtttaccaaa
ttccacgccgagaagatagatagcgccattgagagatatctcgagcaaatcaagagagtg
ctctatgttctggacaaacatttgaacggaaaagaatggttagtgggtgataagtgcact
tttgcagatttgtcgtttgttccatgggatatggctatcccgtggattttcggcgatcga
gttggagaattggagattgagaagaattatccgcattattttgcgtggaataagagattg
atggagagaccttctgtgcagaagattgttaaagataaggcggctgctacgagtggtcat
tag

DBGET integrated database retrieval system