KEGG   Sclerotinia sclerotiorum: SS1G_03650Help
Entry
SS1G_03650        CDS       T01071                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    SS1G_03650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssl01003]
    SS1G_03650
Enzymes [BR:ssl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SS1G_03650
Glycosyltransferases [BR:ssl01003]
 Glycan extension
  Yeast mannan chain
   SS1G_03650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 5491967
NCBI-ProteinID: XP_001595561
UniProt: A0A1D9QCL0 A7EEB0
LinkDB All DBs
Position
Unknown
AA seq 408 aa AA seqDB search
MATGTARYLRYILFAFFGLAIVYFISSSSDQRLQTAQQVFTDKTGIPIKAGTSTSGHSAD
DSKTSDAKTSPNTHDLPPATVPGERMNATFVTLARNADIWEIARSIRQVEDRFNKKFNYD
WVFLNDKPFDSTFKKVTTSLVSGKTHYGEIPEKHWSFPDHIDTEKAKKVREDMAQKKIIY
GDSVSYRHMCRFESGFFFQQELMLNYEWYWRVEPSIELFCDINYDAFKFMADNKKKYSFV
LSLYEYVETIPTLWDSVKKFIKAHPEHIAEGNSMGFLSDDGGETYNHCHMWSNFEIGNLN
WLRSKAYTDYFEQLDQDGGFFYERWGDAPVHSIAAGLLLKKEEIHFFNDIAYYHVPFTHC
PTGEQTRLDLKCHCNPKDNFDWKGYSCTSRFFDINKMEKPEGYESQQD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctacagggacagctagatatttgagatatattctctttgcattctttggtctcgcc
attgtatactttatatcatcttcatccgatcaaaggttacagactgcgcagcaagtcttc
acagacaagactggcatccctatcaaagcaggcacttcaacatcgggtcactctgctgat
gattcaaagacttccgatgctaaaacttccccaaatactcatgatcttccacctgcgacc
gtccctggagaacgcatgaatgcgacatttgttactttggcacgaaacgcggatatttgg
gaaatcgcacgatccattcgtcaagtagaggatagattcaacaaaaagtttaattacgac
tgggttttcctaaatgacaagccattcgattccacattcaagaaagttaccacatccctt
gtttccggaaagactcactatggagaaattccagagaaacattggtcattccccgatcac
attgataccgaaaaggctaagaaggttcgtgaggatatggcacaaaaaaagatcatctat
ggtgattcggtcagctaccgccacatgtgtcgcttcgaatctggtttcttcttccaacaa
gaattgatgttgaactacgagtggtactggagagtcgagccatccattgaacttttctgt
gatattaattacgacgcattcaagttcatggccgacaataagaaaaagtatagtttcgta
ttgagtctttacgaatatgttgaaactatcccaactttgtgggacagtgtcaaaaagttc
atcaaggcccacccagagcacattgccgaaggcaactcaatgggtttccttagtgacgat
ggtggtgaaacttataaccactgccacatgtggtctaacttcgagattggcaacctcaat
tggcttcgatcaaaggcatacacggactactttgagcaactcgaccaagatggaggattc
ttctacgaacgttggggtgatgcaccggttcactccattgctgcaggccttcttttgaag
aaggaagaaattcatttcttcaacgatattgcctattaccacgtccctttcacccattgc
ccaacaggagagcaaacgaggcttgatttgaagtgtcactgcaatccaaaggataacttt
gattggaaaggatactcatgtacgtcgcgattctttgatatcaacaagatggaaaagcca
gagggctatgaaagtcaacaagattaa

DBGET integrated database retrieval system