KEGG   Sclerotinia sclerotiorum: SS1G_04384Help
Entry
SS1G_04384        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00020  Citrate cycle (TCA cycle)
ssl00190  Oxidative phosphorylation
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS1G_04384
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SS1G_04384
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SS1G_04384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2 Fer4_18 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 5491178
NCBI-ProteinID: XP_001594577
UniProt: A7EGE3 A0A1D9PW66
LinkDB All DBs
Position
Unknown
AA seq 301 aa AA seqDB search
MASLRTSARCARSIFAASRPAFRTQMRTMASVQSQTAVDSPTISPSRPVEPASKTSTVKE
PETDSNSLIKTFHIYRWNPDEPASKPRMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFR
RSCREGICGSCAMNIDGVNTLACLCRIPRDAKHETKIYPLPHTYVVKDIVPDLTQFYKQY
KSIKPYLQHTDPAPGGKEYLQSKEERKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAI
LLQSYRWLADSRDQKKEERKAALDNSMSLYRCHTILNCSRTCPKGLNPGLAIAEIKKEMA
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctccgcacaagtgcacgatgtgcacgctcgatatttgccgcctcgcgacca
gctttcagaacacagatgcgtactatggcatcggtccaaagtcaaacagccgtcgacagt
cctaccatttcaccatctcgtcctgtcgaacctgcttctaagacatctactgtcaaggaa
cctgaaaccgattctaactctttgatcaagacattccacatctaccgatggaatccagat
gagccagctagcaagccccgcatgcaatcatatactttggacctcaacaagactggaccc
atgatgttggatgcgctcattagaattaagaacgaagtcgaccctactcttacattccga
agatcttgcagagaaggtatctgcggtagctgtgcaatgaacatcgacggagtaaacaca
ctggcttgtttgtgccgcattcctagagacgccaagcacgagaccaagatctacccacta
ccccacacctatgtcgtcaaggacattgttcctgatttgacccaattttataagcaatac
aagtcgattaagccatatcttcaacacactgatccagcaccaggaggaaaggaatatttg
caatctaaggaggaacgtaagaagcttgatggtctttatgagtgcattctttgcgcatgt
tgttcgacatcttgcccctcctactggtggaacagtgaagagtacttgggaccagctatc
ttattgcaaagttacagatggctcgcagattctcgtgatcagaagaaggaagagcgtaag
gcagctttggacaacagcatgagtttgtacagatgtcacacaattctcaactgctcgaga
acatgtcccaagggattgaatccaggtttggcgattgcggagatcaagaaggaaatggct
ttttaa

DBGET integrated database retrieval system