KEGG   Sclerotinia sclerotiorum: SS1G_04924Help
Entry
SS1G_04924        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00020  Citrate cycle (TCA cycle)
ssl00480  Glutathione metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
ssl01210  2-Oxocarboxylic acid metabolism
ssl01230  Biosynthesis of amino acids
ssl04146  Peroxisome
Module
ssl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS1G_04924
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SS1G_04924
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SS1G_04924
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SS1G_04924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5490183
NCBI-ProteinID: XP_001593497
UniProt: A0A1D9Q9S3 A7EHY2
LinkDB All DBs
Position
Unknown
AA seq 450 aa AA seqDB search
MSLHRSITSSFLRTVPRSSIFTPRFGSAITYSRTMASATSFQKIKVKNPIVELDGDEMTR
IIWKDIKDKFIHPYLDVDLKYYDLGLEYRDETNDQVTIDAAEAIQKYSVGVKCATITPDE
ARVKEFNLKQMWLSPNGTIRNHLGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAFGDQYR
AKDMVVPGPGTLTMTFTPDGGAPTETVVYNFKSGGGVAQTQYNTDESISGFAHASFKLAL
SKGLPLYMSTKNTILKKYDGRFKDIFQEIFDKEYKPQFDEKKIWYEHRLIDDMVAQMMKS
SGGYVMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYREHQK
GNPTSTNPIASIFAWTRGLVQRGTLDNTPEVVAFAESLEQACIDVVDKEGIMTKDLALAC
GNTGKDDYVTTGEYLEAVEKRMKGLLKEKL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccaccgcagcattacctcttcattcttgcgcaccgttcctcgttcctcaatc
ttcacacctcgattcggcagcgccattacctattcgcgcaccatggcttcagctacctct
ttccagaaaatcaaagtcaagaatccaattgtggagcttgatggagatgaaatgacgagg
attatttggaaggatattaaggataaatttattcatccttatctggatgttgatttgaaa
tattatgatttgggtttggagtatagagatgagacaaatgatcaggttactattgatgcc
gcagaggctattcagaagtattccgttggtgttaagtgcgctactattactccggatgaa
gctagagttaaggagttcaatttgaagcagatgtggctctcacctaatggaaccatccgt
aaccatctcggcggtacagttttccgcgaacctattgtcattcctcgtattcctcgtctc
gttcctggatggaagaaacctattatcatcggtcgtcatgcattcggagatcaataccgc
gcaaaagatatggttgttccaggtccaggtacccttaccatgactttcacacctgatgga
ggcgcacccaccgaaactgttgtctataactttaaatcgggaggaggagttgctcaaact
caatataatactgatgaatccattagtggatttgctcatgctagtttcaaattggctctt
agcaagggattacctttgtatatgagtactaagaatacaattttgaaaaagtatgatgga
agattcaaggatatcttccaggagatttttgacaaggaatataaacctcaatttgatgag
aagaagatttggtatgaacatcgattaattgatgatatggttgcgcaaatgatgaagagt
tcaggtggttatgttatggctttgaagaactacgatggagatgttcaatccgatattgta
gctcaaggatttggttcccttggtctcatgacctcagtactcatcacccctgatggaaag
acctttgaatccgaagccgcccacggaaccgtcactcgtcattaccgcgaacatcaaaaa
ggtaaccctacctccaccaaccctatcgcatcaatctttgcttggacaagaggtctcgtc
caaagaggtactttagataatacaccagaagtcgttgctttcgcagaaagcttagaacaa
gcttgcatagatgtagttgataaggagggtatcatgacgaaggatttagcattagcttgt
ggaaacacaggaaaggatgattatgttactactggggagtatttggaagcagtagaaaag
aggatgaagggacttttgaaggagaaattgtag

DBGET integrated database retrieval system