KEGG   Sclerotinia sclerotiorum: SS1G_05934Help
Entry
SS1G_05934        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00020  Citrate cycle (TCA cycle)
ssl00310  Lysine degradation
ssl00380  Tryptophan metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS1G_05934
  09105 Amino acid metabolism
   00310 Lysine degradation
    SS1G_05934
   00380 Tryptophan metabolism
    SS1G_05934
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SS1G_05934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 5488859
NCBI-ProteinID: XP_001593012
UniProt: A0A1D9Q4G2 A7EKT7
LinkDB All DBs
Position
Unknown
AA seq 1048 aa AA seqDB search
MLRTSLRQSSSQLLRGGCSARTLCTTSRSPLFVSNVTSKSALASKRRSLAITSQKRHEST
TASAPDPNDNFLSGNTANYIDEMYMQWKEDPSSVHISWQVYFRNMESGDMPMSQAFTPPP
TLVPTPTGGVPSFLPGLGGAEGSEVTNHLKVQLLCRAYQARGHHKADIDPLGIRREAEEF
GYSKPKELQLEHYQFTEKDLDTEYSLGPGILPHFKKAGREKMTLREIIAACERIYCGSYG
VEYIHIPDREQCDWLRARIEVDKPFKYSIDEKRRILDRLIWSSSFENFLATKYPNDKRFG
LEGCETLVPGMKALIDRSVDFGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFGGSAAA
EDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKD
HKTAMGVLLHGDAAFAAQGVVYECLGFHSLPAYSTGGTIHLVVNNQIGFTTDPRFARSTA
YCTDIAKSIDAPVFHVNADDVEAVNYVCQLAADWRAEFQRDVVIDLVCYRKHGHNETDQP
SFTQPLMYKRIQKHKSQIDIYIDQLLKDGSFTKDDIDEHRKWVWGMLEDSFAKSKDYQPT
SKEWTTSAWNGFKSPKELATEVLPHNPTGVPGHTLEHIAETIGSYPEGFNVHRNLKRILT
NRIKTVSEGQNIDWSTAEALAFGTLVGEGHHVRVSGQDVERGTFSQRHAVFHDQETEKTY
TPLQHISKDQGKFVISNSSLSEFGCLGFEYGYSLSSPDALVMWEAQFGDFANNAQCIIDQ
FVASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRVFPSPEKLDRQHQ
DCNMQIAYMTSPSNLFHILRRQMNRQFRKPLIIFFSKSLLRHPIARSSIDEFTGDSQFRW
IIPDAEHGKSINEPENIERVILCTGQVYAALSKYRADNNIKDTAFTRIEQLNPFPWQQLK
ENLDMYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTQYHDRKHVMYAGRDPSASVAT
GLKASHTKEEAKLLETAFSVTQDKLKGE
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaacttcactgaggcaatcgagcagccagctcctaagaggtggctgctcagct
agaaccctttgcacaacctcacgatctcccctcttcgtctcaaatgtcacatcgaaatcc
gccctcgcatcgaaaagacgttctctagctatcacctcccaaaagagacatgaatcgact
actgcaagtgccccagatccaaatgataactttctctccggaaataccgcaaattacatt
gatgagatgtatatgcagtggaaggaggatccatcgagcgtgcatatatcatggcaggtc
tacttcagaaatatggagagtggcgatatgccaatgtcgcaagctttcacccctcctcca
actttggttcctacacctaccggaggagtaccaagtttcttgccaggcttgggcggtgca
gaggggtcagaagttacaaatcatttgaaggtccagttgttgtgccgtgcatatcaagct
cgtggacatcacaaagcagatatcgatcctctcgggattagacgggaggctgaggaattt
ggctacagcaaacccaaggagcttcaactcgaacattatcaatttactgagaaggatctg
gataccgagtattccctgggacctggtattctaccacatttcaagaaagcaggccgtgag
aagatgacattgcgcgagattattgcggcatgcgaacgtatctattgcggttcctacggt
gtcgaatacattcacatccctgacagagaacaatgtgattggctacgagctcgaattgag
gtcgacaagccgttcaaatactcgattgatgagaagcgccgaatcttggatcgtttaatc
tggagttcaagtttcgaaaatttcttggctaccaaatacccgaacgacaagcgtttcggc
ttggaaggttgtgagacattggttcctggtatgaaggctctgattgacagaagtgtcgac
tttggagttaaagacattgttattggaatgcctcatcgtggtcgtttgaacgttctcagt
aacgttgtccgaaaacccaacgagtcgatcttcagtgaatttggtggttcggcagctgcc
gaagatgaaggttccggcgatgtcaagtaccatcttggaatgaacttcgagcgtccaact
ccttctggcaaacgtgttcaactttccttggttgccaatccttcccatctcgaggctgaa
gaccccgtcgtccttggtaaaactcgagctatccaacactataacaacgacgagaaagac
cacaaaaccgctatgggcgttctcctccacggtgatgcagcttttgctgctcaaggtgtt
gtctacgagtgtttgggtttccattctttgcctgcgtactccacaggtggtaccattcac
ttagtcgtcaacaaccaaattggtttcaccaccgatccacgttttgctcgatcaactgct
tactgcaccgatattgccaagtcaattgatgctccagtcttccacgtcaacgctgatgat
gttgaagctgtcaactacgtttgtcaattggccgctgattggcgtgccgagttccaacgt
gatgttgtcattgatctcgtctgttacagaaagcatggtcacaacgagactgatcagcca
tcttttacgcagcctttgatgtacaagcgcatccagaagcacaagtctcaaattgacatt
tacattgaccaacttctcaaagatggtagctttaccaaggatgatattgatgagcacaga
aagtgggtctggggaatgttggaggatagcttcgccaagagcaaggattaccaaccgaca
tcaaaggagtggacaacctctgcttggaacggcttcaaatcacctaaggaacttgctacg
gaagttcttccacacaaccccacaggtgtaccagggcacactttggaacacattgctgaa
acaattggttcatacccagagggctttaacgttcatcgtaaccttaagcgtatcttgact
aaccgtatcaagaccgttagtgaaggacagaacattgactggtcaacggctgaagctctc
gcattcggtacccttgttggcgaaggtcaccacgttcgtgtttccggtcaagatgttgag
cgtggtactttctcacaaagacacgctgtcttccatgatcaagagaccgagaaaacctac
acacctttacaacatattagcaaagatcaaggaaagttcgtcatttctaactcttcattg
agtgaatttggttgtcttggtttcgaatatggttactctttgtcttcgccagatgctctt
gtcatgtgggaggctcaatttggtgatttcgccaacaacgctcagtgcatcattgatcag
ttcgttgcttccggtgaggtcaagtggatgcaaagatccggtctcgtcatgtcgttgcct
cacggttatgacggacaaggacctgagcattcatccggtcgtatggagagatatcttcaa
ctctgtaacgaagatcctcgtgtcttcccatccccagaaaagctcgaccgccaacatcaa
gattgtaacatgcaaattgcttacatgacatcaccatctaacttgttccacatcttaaga
aggcagatgaatagacaattccgtaaacctctcatcattttcttctccaaatctctcctc
cgtcaccctatcgcccgttcatcaattgatgaattcactggtgactcacaattccgctgg
attattcctgatgccgaacatggcaaatctatcaacgagcctgagaacattgagcgtgta
atcctctgcacgggacaagtatacgccgctctcagcaaataccgcgccgacaacaatatc
aaggacacagcctttactcgtatcgaacaactcaaccccttcccatggcaacaactcaag
gagaacctcgacatgtatcccaacgccaagaccattgtctggtgtcaagaagaacctctc
aatgccggtgcttggagtttcacccaacctagaatcgagaccttgttgaacaacactcaa
taccatgacaggaagcacgtcatgtatgcaggtagagatccaagtgctagtgtcgccact
ggtctcaaggccagccatacaaaggaggaagcgaagttgttggagacagctttcagcgtt
acccaagacaagttgaagggagaataa

DBGET integrated database retrieval system