KEGG   Sclerotinia sclerotiorum: SS1G_06246Help
Entry
SS1G_06246        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SS1G_06246
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SS1G_06246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 5489011
NCBI-ProteinID: XP_001593324
UniProt: A7ELP9 A0A1D9Q3R0
LinkDB All DBs
Position
Unknown
AA seq 230 aa AA seqDB search
MSTTLLRTSAAARPALRASSSKRAASMASTSFVRGKATLPDLPYDYGALEPSISGKIMEL
HHKKHHQTYVNSFNTASEQLEAAESKGDIAAAIALQPLINFHGGGHLNHSLFWENLAPSK
NGGGGEPAGTLKTAIETSYGDFSSFKTKFNAALAGIQGSGWAWLVKDNETGQVQIKTYAN
QDPVVGKFTPLLGVDAWEHAYYLQYENRKAEYFSAIWDVINWKTVEKRLK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtccactacacttcttcgcacatctgctgcagctcgtcctgctcttagagctagctct
tccaaacgggctgcttcaatggcaagcacaagcttcgtccgtggaaaggctactcttccc
gatcttccatatgattatggcgcgcttgaaccttccatctccggcaagatcatggagctt
catcacaagaagcatcatcaaacttacgtcaacagcttcaatactgcgagcgagcaactt
gaggccgctgaatccaagggagacattgctgctgccattgcattacaacccctcattaac
ttccacggtggcggacatttgaaccacagtttgttctgggaaaatttggcaccaagcaag
aatggtggtggtggagaacctgcaggtactttgaagactgcaattgagaccagctatgga
gacttctcatccttcaagaccaaattcaacgcggcattggcaggcattcaaggtagtgga
tgggcgtggttagtcaaggataacgagactggtcaagttcaaatcaaaacatacgcaaac
caagatccagtagtgggcaagtttactcccttgttgggtgttgatgcttgggagcatgct
tactacttgcaatacgagaacagaaaggccgagtatttcagtgctatctgggatgtgatt
aactggaagactgtcgagaagagattgaagtga

DBGET integrated database retrieval system