KEGG   Sclerotinia sclerotiorum: SS1G_06623Help
Entry
SS1G_06623        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
Organism
ssl  Sclerotinia sclerotiorum
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 5488843
NCBI-ProteinID: XP_001592382
UniProt: A7EMS4 A0A1D9QI72
LinkDB All DBs
Position
Unknown
AA seq 621 aa AA seqDB search
MESVNSGLHQQIPTPYRQLQPQAEQALQHGQPHLSHHTLASQQGLDLSGLVQDDNNSVYP
DLRSLQDPNTGHSVVHQYPSPIPFDRNNAHQQMHVQNTGSPHTPQQQHPGQGQFGILTAG
PPLHHNPIGRLQQTLQQDDDLFGTPDESDQKSTGHHSHKIIPNPPNLEAWREKLFNVDEM
ITLSEEEYNTYFPHVDNVYSHRSTQKYKRKPFVSHYWDCRLKGRPPGTAKSDDPNKKKRK
RTARERDLCDVKIKITEYFPGAMLRADFQPDGGPSGDPSQANNYFAQAGAHQQQFALPLN
GIGIPPNHPGATGQRYYTIQRVNGNGGNGKGDGVAGPHKHDLKRSDEIKKNSIVRFLQKR
EKEDKKTQKTYHKRASGLALSTVKKHSKENDLKLFASCFCPFVQRVWIALEAKGIQYQYI
EVDPYKKPQSLLEVNPRGLVPAIRHGDWGCGESTVLMEYLEDLQIGPPLLPQDAQAKAHC
RLWSDHIDRKIVPAFYQLLQNQDFNKQAESTRKLRDEISQIVDVCDPQGPFFLGSTLSYT
DVHFAPWILRCSRVLKHYRGWQDPQPGSRWAIWFDAIENNEFVKATTSMDELYIDSYERY
AMNRPNTSELADAVNGGYNLP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagtaaattcaggtctacaccagcagatacccactccctacagacaactacag
ccgcaagccgaacaagctcttcagcatggccaacctcatctcagtcaccacactcttgca
tcacagcagggtctcgatctgtcgggtttggtccaagatgataacaattccgtctatcca
gacttgagaagcttgcaggatccaaatacgggacattcggtggttcaccaatatccttct
cccattccttttgatcgaaataatgctcaccaacagatgcatgttcaaaacacgggtagt
ccgcataccccacaacagcagcatcctggacaaggtcaatttggaatcttgactgcaggt
cctcctcttcatcacaatcccattggcagattgcagcaaactttgcagcaagatgatgat
ttatttggcacgccagatgaatcagatcaaaaaagtaccggtcatcattctcacaagatc
atccctaatcctccaaatttggaagcatggagagaaaagttatttaatgttgatgagatg
atcaccttgagtgaagaagaatataacacttactttcctcacgtcgataatgtttattct
catcgatctactcaaaagtataagcgcaagccttttgtttctcattattgggattgtcgt
ctcaaaggtcgaccaccaggaactgccaaatctgatgacccgaataaaaagaagcgcaag
cgcactgcaagagaaagagatctttgtgatgtcaagattaagattacagagtactttcca
ggtgctatgttgcgagcagactttcaaccagatggaggaccgtcaggagatccatctcaa
gccaataactattttgctcaagctggagctcaccaacaacaatttgctcttcctttaaat
ggtataggtatcccaccaaatcatccaggcgcaacaggccaacgatactatacaattcaa
cgtgtcaatgggaatggtggcaatggtaagggtgatggtgttgcagggcctcataagcat
gatttgaagagaagtgatgagatcaagaagaacagtattgtacgatttcttcaaaagaga
gaaaaagaagataagaagacacagaaaacttaccacaagagagctagtggtttagctctg
agcaccgtcaagaaacattccaaggagaatgatttgaagttattcgccagttgcttttgt
ccttttgttcagcgagtatggattgctttagaagccaagggtattcagtatcaatatatt
gaagttgatccatataagaagcctcaatctttgttagaagtcaatcctagggggctggtt
cccgctattcgtcatggagattggggttgtggtgaaagtactgtattgatggaatatctc
gaggatcttcaaattggtccacctctccttcctcaggatgctcaagctaaagctcattgt
agactttggagtgaccatattgatcggaaaatcgtccccgcattttatcaacttctccag
aaccaagacttcaataagcaagccgaaagtaccaggaaacttcgcgatgaaatatctcaa
atcgttgatgtttgtgatcctcaaggtccattcttcctcggatcaactctttcttacact
gatgttcattttgcaccctggatccttcgctgcagtcgggttcttaaacattatcgaggc
tggcaagatcctcaaccaggtagccgatgggcaatttggttcgatgccatcgagaataat
gagtttgttaaggctaccactagtatggatgaattgtacatcgatagttatgagagatat
gcaatgaatcgaccaaatactagtgaattagctgatgcggttaatggtggttataattta
ccttag

DBGET integrated database retrieval system