KEGG   Sclerotinia sclerotiorum: SS1G_07864Help
Entry
SS1G_07864        CDS       T01071                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00020  Citrate cycle (TCA cycle)
ssl00190  Oxidative phosphorylation
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS1G_07864
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SS1G_07864
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SS1G_07864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 5487337
NCBI-ProteinID: XP_001591238
UniProt: A0A1D9QEX1 A7ERB0
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSSFAMRRFTAGPSFSRALKNQTRSFSSTRPAARIITHAPLRAKEASPFVSNKYPVVDHE
YDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGKIYQRAFGGQSQKFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMEDGECKGVIAYNQED
GTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPDK
DHIYLQLSHLPPDVLHERLPGISETASIFSGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDAEGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFEPGMP
HKEISADAGAESISVLDQIRTADGTKSTHEIRLAMQKTMQTDVSVFRTQESLDEGVTKIN
AVDQTFNDIKTQDRSMIWNSDLVETLELRNLLTCAVQTAEAAAARKESRGAHAREDYPER
DDNEWMKHSLTFQKKPQGKTDLTYRAVVGHTLDENECKAVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatttgctatgcgtagattcacagctggtccttcgttctcgagggcattgaaa
aatcaaaccagatccttctcatcgacgagacctgcagcgagaattatcacacatgcgcca
cttcgagcaaaggaagcctcgcctttcgtgagcaacaaataccccgtcgtagatcacgaa
tatgacgctattgtcattggtgctggaggagctggtttaagagcagcattcggtcttgcg
gaagctggtttcaacactgcatgcatatcgaaacttttcccaactcgatcacacacggta
gcagcgcaaggaggtatcaatgccgctttgggtaatatgcacgaagatgactggagatgg
cacatgtacgatactgtcaagggttcagattggttaggagatcaagacgctattcattat
atgacaagagaagcaccagcatctgtcattgagttggaaaactatggttgcccattttca
agaacggacgacggcaagatctatcaacgtgccttcggtggtcaatcacaaaagttcgga
aagggtggtcaagcatacagatgttgtgcagctgctgacagaaccggacatgcacttctc
cacactctttacggtcaatctttaaggcacaacacaaactactttatcgaatacttcgct
ctcgacttaatcatggaggatggtgaatgtaagggagtgatcgcatacaaccaagaagac
ggtacactccacagattccgcgcacacaacactgttttggccaccggtggttacggacgt
gcttacttcagttgtacatctgcacacacttgtactggtgatggaatggctatggtcgct
cgtgcaggattacctaaccaggatcttgaattcgttcaattccatcctaccggtatttat
ggcgctggttgcttgatcactgaaggtgctcgtggtgagggtggatatcttctcaactct
gagggtgaaagatttatggaacgttacgcaccaactgctaaggatttggcttctcgtgat
gtggtttccagatcaatgaccatggagatcagggaaggacgtggtgttgggccagacaag
gatcacatttacctccaactcagccatcttccacctgatgttctgcacgaacgtcttcca
ggtatttctgagaccgcatccattttctctggtgtcgatgttaccaagcaacctatccca
gtcctcccaaccgtccactacaacatgggtggtatcccaaccaagtacactggtgaggtt
ctcactgttgatgctgagggtaaggataaggttgtaccgggtctttttgcatgcggtgaa
gctgcttgtgtttccgtacatggtgccaaccgtctcggagccaactcacttcttgatttg
atcgttttcggccgtgcagtatcccacacaattcgcgataacttcgagcctggtatgcca
cacaaggagattagcgccgatgctggtgccgaatctattagcgtccttgaccaaatcaga
actgccgatggcactaagagcacacacgaaatccgtctagctatgcaaaagaccatgcag
acagatgtcagtgtgttcagaactcaagagagtttggatgagggtgtcaccaagattaac
gctgtcgatcaaacattcaatgatatcaagacccaagaccgaagtatgatctggaactcg
gatttggttgaaaccttggagttgagaaatttgttgacttgcgctgttcaaaccgccgag
gcagctgccgccagaaaggaatctcgaggagcacatgcccgtgaagattacccagagaga
gatgacaatgaatggatgaagcattctttgaccttccagaagaagccacaaggaaagact
gatttgacctacagagccgtcgttggtcacaccctggatgagaatgagtgcaaggctgtt
ccaccattcaagcgtgtatactag

DBGET integrated database retrieval system