KEGG   Sclerotinia sclerotiorum: SS1G_09189Help
Entry
SS1G_09189        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00562  Inositol phosphate metabolism
ssl01100  Metabolic pathways
ssl01130  Biosynthesis of antibiotics
ssl04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SS1G_09189
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SS1G_09189
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     SS1G_09189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 5485745
NCBI-ProteinID: XP_001589468
UniProt: A7EV31
LinkDB All DBs
Position
Unknown
AA seq 353 aa AA seqDB search
MAATVTLPDEELKEIYAFALDLGRKAGKILMEGVEKRCEGDNGGKEEEKMNAVDIVTQTD
LDVEAFVKHEILSKYPSHKFIGEETYSSGSSKQYLVDSSPTWIVDPLDGTVNYTHLFPMF
CISIAFCLNGIPIIGVIYAPVLDVSYSALVGHGAWENDHLGVGNGVASGGGSSASGILKR
KRQLPYVKGKPLGKEAPKGCTFSCEWGKDRRDIEGGNLRKKIDSFVNLASEIGGRGGKGG
MVHGVRSLGSATMDLAYTATGAFDIWWEGGCWEWDVAAGICILREAGGLITTANPPSNPE
TDPIEEVKLGSRLYLAIRPAGATATETGRQQQERVVREVWKRVEALDYTRPGA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctgccacggtaaccttacccgatgaagaacttaaggaaatctacgcatttgcgttg
gatttggggaggaaagcgggaaagatattgatggagggggtggagaagagatgtgagggg
gataatgggggaaaggaagaggaaaagatgaatgcagtggatattgttacgcagactgat
ttggatgtcgaggcatttgttaagcatgagatattaagtaaatatccatcacataaattc
atcggagaagaaacctattcctccggctcctccaaacaatatctcgttgattcttcacct
acctggattgtagaccctctcgacggaacagtaaattacacgcatttattccctatgttc
tgcatctccattgccttctgtctcaatgggattcctattatcggagtcatctatgccccc
gttcttgatgtatcttattctgctcttgtgggtcacggcgcatgggaaaatgatcactta
ggagttggcaatggtgttgcttctggaggaggtagctctgcttctgggattctgaagaga
aaaagacagttaccgtatgtgaagggcaaaccattgggtaaagaggcgccgaaggggtgt
acatttagttgtgagtgggggaaggataggagggatattgaggggggaaatttgaggaag
aagattgatagttttgttaatttagcgagtgaaattggtgggaggggtggtaaaggggga
atggttcatggggttcggagtttggggagcgcgacaatggatttagcctacacagcaaca
ggagcctttgacatttggtgggaaggaggttgttgggaatgggacgtagcagcaggaatc
tgcattctccgcgaagcaggcggtttaataaccactgccaacccaccctccaatccggaa
accgatcctatcgaagaagtaaaattgggtagtcgcttatatttagccattagaccagca
ggcgccacagctacagaaacaggacggcagcaacaagagcgcgtcgtgcgcgaggtatgg
aaacgtgttgaggcgttggattatacacgtcctggggcttag

DBGET integrated database retrieval system