KEGG   Sclerotinia sclerotiorum: SS1G_10282Help
Entry
SS1G_10282        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00270  Cysteine and methionine metabolism
ssl00330  Arginine and proline metabolism
ssl00410  beta-Alanine metabolism
ssl00480  Glutathione metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SS1G_10282
   00330 Arginine and proline metabolism
    SS1G_10282
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SS1G_10282
   00480 Glutathione metabolism
    SS1G_10282
Enzymes [BR:ssl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     SS1G_10282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 DUF43 Methyltransf_12 Methyltransf_18 DREV
Motif
Other DBs
NCBI-GeneID: 5484713
NCBI-ProteinID: XP_001588735
UniProt: A7EY67
LinkDB All DBs
Position
Unknown
AA seq 292 aa AA seqDB search
MSEITHPTIKDGWFREISEMWPGQAMTLKVKNVLHHEKSKFQDVLIFESTDYGTVLVLDN
VIQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDE
AVIRLSKKYLPGMAISYQHPKVKTHIGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQK
PYFELLFGALKEGGVITTQGSENQWLHLPLITKLKKDCKEVFPNVEYAYTTIPTYPSGQI
GFMVCCKDADRDLSKPVRKWSPEEEEKLCRYYNAAIHEASFVLPTFARAALK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagatcacccaccccactatcaaggatggctggttccgcgaaatttccgagatg
tggcctggccaggcaatgaccctcaaggttaagaacgtccttcaccacgagaagagcaaa
tttcaagatgttttaattttcgagtccactgattatggcaccgtcttggtcctcgacaat
gtcattcaatgcactgagcgcgatgaattctcataccaggagatgatcacccacttggct
atgaactcccaccccaacccaaagaaggtcttggtcattggtggaggggatggaggtgtc
ttgcgtgaggtggtcaaacacgattgtgtagaggaagcaatcctctgcgacattgatgag
gccgtcatccgtctttccaagaaataccttcctggaatggctatcagctatcaacacccc
aaggtcaagactcacatcggtgacggattcaaattcctggacgattacaagaacgaattt
gatgttatcatcaccgattcttccgacccagagggacctgccgaaagtttgttccagaag
ccatactttgagttgctatttggtgctcttaaggagggtggcgtcattaccacacaaggt
tccgagaaccaatggctccacctcccattgatcactaagctcaagaaggactgcaaagaa
gtattccccaacgtcgaatacgcctataccaccattcctacatacccatctggccaaatt
ggattcatggtatgctgtaaggacgccgatcgcgatctcagcaagcctgtccgcaaatgg
tccccagaagaggaggagaagttgtgccgctactacaacgctgctatccacgaagcaagc
tttgtcttgccaactttcgcccgtgctgcattgaagtag

DBGET integrated database retrieval system