KEGG   Sclerotinia sclerotiorum: SS1G_10617Help
Entry
SS1G_10617        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00500  Starch and sucrose metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SS1G_10617
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SS1G_10617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 5484230
NCBI-ProteinID: XP_001588171
UniProt: A7EZ51 A0A1D9QBQ1
LinkDB All DBs
Position
Unknown
AA seq 679 aa AA seqDB search
MASSLLSALTSLNSISNFNSTLVLRAVQPIMHTFTPLLLAGSLALQSIHAFPNPSRVEER
DGEILKRSVDSFIATESPIAMRNLLCNIGSSGSCAAGASSGIVIASPDKVNPDYFYTWTR
DSALVFKNLVDTFISSTYSPSLQQQIEDYISAQAGLQTVSNPSGGFSSGGLGEPKFNVDK
TAFTGAWGRPQRDGPALRATAMIAYSKWLIANGYTSTVQTIVWPIIRNDLSYVTQYWNQT
GFDLWEEVQGSSFFTIAAQHRALVEGSALASQIGQSCTYCDSQAPQVLCFLQSFWSSSSG
YIISNINENNGRSGKDANSILSTIQTFDPTASCDSSTFQPCSDRALANHKVVTDSFRSIY
SINSGIAEGVAVSVGRYPEDSYQGGNPWYLNTLAAAEQLYDALYTWNKQGSITVTSTSLA
FFRDFSSSVTAGTYSSSTSTYTTLYNAIKTYADGYMNIVATYAQANGSLSEQFNRAGGAP
LSAYDLTWSYAAFLTAAARRAGVVPYSWGEPSANSVPGSCYATSAYGTYSTATATSFPAS
QTPNGSGSVPAPSTTATTTKTGSSTTTTASSCPIATSVAVTFNELKTTVYGQTIKIAGSI
SQLGSWAPASAVALSASKYTSSNPLWSVTINLPAGTAIQYKFINVASDGTVTWEADPNRS
YTVPVSCATSATVSGSWQS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctttactttccgccctcacctctctcaactccatcagcaacttcaatagc
acactcgttcttcgcgccgtgcaacccatcatgcacacctttacccctctcctgctggct
ggcagtcttgccctccaatctattcatgcttttccaaatcccagccgggttgaggaacgg
gatggcgaaatattgaaacgttcggtggactctttcatcgccactgaaagtccaattgcc
atgagaaatcttttgtgtaatattggatcaagcggatcttgtgctgcaggagcatcttcc
ggcattgtaattgcttcacctgacaaagtaaacccagactatttttacacttggactcga
gactctgcattggtcttcaagaaccttgtggatacattcatcagcagcacttattctcca
tcacttcaacaacagattgaagactacatcagtgcccaagcaggtcttcagaccgtatca
aacccttccggtggtttctcatctggcggcctgggcgagcccaagttcaatgtcgataaa
acggctttcacaggagcttggggtcgtcctcaaagagatggaccagccttacgtgctact
gctatgattgcttattcaaaatggttgatcgccaacggctatacctctaccgtgcaaacc
atcgtttggcctattatcagaaatgatctctcatacgttactcaatactggaaccaaact
ggttttgatctttgggaagaagttcaaggatcaagtttcttcactatcgccgctcaacat
cgtgcacttgttgaaggtagcgcattagcctcccaaatcggtcaaagctgtacctattgt
gattctcaagccccacaagttctttgcttcctccaaagcttctggagttcatcttctgga
tacatcatttccaacatcaatgaaaacaacggacgatcaggaaaagatgcaaacagtatc
ttgagtactatccagacctttgaccctactgcttcatgtgattcttccacattccaacca
tgctcagaccgtgctttggcaaaccacaaagttgtcaccgattctttcagatcaatttat
tccatcaactctggaattgccgagggtgttgcagtttctgttggacgttatccagaagat
tcgtaccaaggtggtaacccttggtacctcaatactctcgccgctgctgaacaactttac
gatgctttatacacctggaataagcaaggttccatcacagtgaccagcacctccctcgca
tttttcagagacttcagctcttctgtcactgccggaacatactcttcttcaacatcaacc
tacactactctatacaacgctatcaaaacatacgccgacggctacatgaacatcgttgca
acctatgcccaagccaacggttctctctcagagcaattcaaccgagccggaggagcccca
ctctcagcctacgacctcacctggtcctacgccgccttcctcaccgccgccgctcgtcgc
gcaggcgtcgtcccatactcatggggtgagccatccgccaacagcgtccccggaagctgc
tacgcaacatccgcatacggcacctactccactgcaaccgccacctcgttccccgcatcc
caaacccctaatggaagcggaagcgtcccggctcccagcaccacagccaccacgaccaaa
accggctcctcaaccacaaccaccgcatcctcctgccccatcgccacctccgtcgccgta
accttcaacgaactcaaaactacagtttacggccaaaccatcaaaatcgctggttcaatt
tctcaattaggttcctgggctcccgcttccgctgtcgctttgagcgctagcaaatatacc
tccagtaaccccttgtggagcgtcactatcaacttacccgccggaacagccatccagtat
aaatttatcaatgtggcgagcgatggaacggttacttgggaggcggatccaaatagaagt
tataccgttccagttagttgtgcaaccagcgcaacggttagtggaagttggcagtcgtag

DBGET integrated database retrieval system