KEGG   Sclerotinia sclerotiorum: SS1G_11039Help
Entry
SS1G_11039        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl03030  DNA replication
ssl03410  Base excision repair
ssl03420  Nucleotide excision repair
ssl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SS1G_11039
   03410 Base excision repair
    SS1G_11039
   03420 Nucleotide excision repair
    SS1G_11039
   03430 Mismatch repair
    SS1G_11039
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssl03032]
    SS1G_11039
   03400 DNA repair and recombination proteins [BR:ssl03400]
    SS1G_11039
Enzymes [BR:ssl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SS1G_11039
    6.5.1.6  DNA ligase (ATP or NAD+)
     SS1G_11039
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SS1G_11039
DNA replication proteins [BR:ssl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SS1G_11039
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SS1G_11039
DNA repair and recombination proteins [BR:ssl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SS1G_11039
   NER (nucleotide excision repair)
    Other NER factors
     SS1G_11039
   MMR (mismatch exicision repair)
    Other MMR factors
     SS1G_11039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 5483850
NCBI-ProteinID: XP_001587799
UniProt: A7F0C2
LinkDB All DBs
Position
Unknown
AA seq 820 aa AA seqDB search
MGTPTKRRKLNNDTKSNGSRNLDFFFGKRKKEEQELPSQLVGSPSQDVPDGAGPSELTDE
QLARKLQEEWDREPVGTNEATEGFLVETNRQPSATPVSAISTSHTSEKAPSDGIFSRPTT
KPTKPIINKNTLSLQSAGTAEDTISTQSRIKIVDTLVNLLRVIIEGDPDSLLHTVWLATN
AISPPYISLELGLGGSAISKALKNVCGLDSRSLKTLYNKHGDAGDVAFEAKKRQSFTLRK
PKPLTIKGVYQSLVKIAKTQGTGSSEIKQRIVDRLLQDARGAEESRYIVRTLCQHLRIGA
VKTTMLIALSRAFQLSRPPGADFPLKSQQELVKLKKEVLAELWSKGEEIVKACFAKRPNY
NDLIPILLEIGVCEELLVRCGLALHIPLRPMLGSITRDLAEMLTKLQGRDFSCEYKYDGQ
RAQVHCDENGKVSIFSRHLELMTDKYPDLVALIPKIRGEGVESFIMEGEVVSVDRQSGDL
KTFQSLANRARKDVAIGSVTIDVCLFSFDLMYLNGESLLNRTFRERRELLRGLFVEVPNQ
FTWVKSIDATSQDSEVVLEFFNTAIERKCEGIMVKILDDLPSTTLLESEEVSEEIEPSIL
QTSQKQSRGKTKSAEKEPEKKTRRKALLSTYEPDKRLDSWLKVKKDYSASFDTLDLIPVA
AWHGQGRKAKFWSPILLAVRNDETGTLEAVCKCISGFSDAFYKVNKEFYAEGGEHVLGGK
PNYVDYRGGHPDVWFEPQEVWEMAYADITISPVYRAAIGLVSDEKGLSLRFPRFLKKRED
KSIEEASTSEFLAGLWRKQEQKVDDGKEKSEEIYLEDDEE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggggacacctacgaagcggaggaagctcaacaatgatacaaagtccaatggttctcgg
aatctcgacttcttttttggaaagcgaaagaaagaggaacaagagttgccatctcaacta
gtgggtagtccatcccaagatgttcccgatggcgccggtccctctgaattgacagacgag
caactggcaagaaagctccaggaggaatgggatcgggaaccagttggcacaaatgaggcg
actgaaggttttctagtcgaaaccaatcggcagccatctgcgactccagtctccgccatc
tctaccagccatacaagtgagaaagcaccgagtgatggcattttcagtcggcctaccaca
aaaccaactaaaccgattatcaataagaataccctttcactacaatccgctggcacagca
gaagatactatatctactcagagccgtataaaaatagtagatactctggtcaacttgctg
agggtcatcattgagggtgatccagattcgcttctacatactgtctggctcgcgacgaat
gcaatatcaccaccatacatatccctcgaactaggtttgggtggttcggccatttcgaaa
gcattgaaaaacgtgtgcgggctagattcaaggtcgttgaagacactttataacaagcac
ggtgatgctggcgatgttgcttttgaagctaagaagagacagagttttaccttaagaaaa
ccgaaaccactaacgataaaaggagtctatcaatctctagtcaaaatagctaagacacaa
ggaaccggcagtagcgagatcaagcaaagaattgtcgatcgattattgcaagacgccaga
ggagcagaggagagtcgatacattgtccggaccctctgtcaacatctccgtattggtgca
gtgaaaaccacaatgttgattgctttatctcgagcttttcagctatctagaccacctgga
gcagactttcctcttaagtcacaacaagagctggtaaagctcaaaaaggaagtcctggcc
gagttgtggtcgaagggtgaagaaattgtgaaagcatgcttcgctaaaaggcccaattac
aacgaccttatacccattttacttgagatcggagtctgcgaggagctattggttagatgc
ggactagccttgcatattccgttacgccccatgttagggagcattaccagggatcttgca
gaaatgcttacgaagcttcaaggtcgtgatttcagttgtgagtataagtatgatgggcag
cgagcccaagtccattgtgatgagaatggaaaagtgtccatattttccaggcacctggaa
cttatgacagacaaatatcccgatttggtggccttgattccaaaaatacgtggggaaggt
gtcgaaagtttcatcatggaaggagaggtagtctccgttgatcggcaatctggtgatctg
aaaaccttccaatctctggcaaatcgagcgaggaaagatgtagcaattgggagtgttacg
attgatgtgtgtctcttctcctttgatttaatgtacctgaacggagaatcacttctcaat
cgaactttcagggaaaggcgagaacttttacgaggtttgttcgttgaggtaccgaaccaa
ttcacatgggtaaaaagtatcgatgctacttctcaggattcagaggttgtcttagaattc
ttcaacactgccatagaacgaaagtgcgagggcatcatggttaagattttagatgattta
cctagcactacactacttgagtccgaggaagtctcggaagagattgagccctctatcctc
caaacatcccaaaaacaatccagagggaagacgaaatctgctgaaaaagaacccgagaag
aaaacgcgccgaaaagctttattatccacgtacgagcccgacaaacgactggactcttgg
ctgaaagtgaaaaaggattacagtgcttcatttgatacgttggatttgatacctgtcgct
gcatggcatggtcaaggacgtaaggcgaaattctggtcaccaattctccttgcagttcgc
aacgatgagactggcactctggaagccgtgtgtaagtgtatctcgggttttagtgacgca
ttctacaaggtcaacaaagaattctacgcagaggggggcgagcatgttctaggaggaaaa
ccaaattatgtcgattatcgaggtgggcaccccgatgtatggttcgaaccgcaagaggtc
tgggagatggcttatgcggatattacaattagtccggtgtatagagccgccatcggtctt
gtgagcgatgaaaagggattaagtttgaggttccctagattcttgaaaaaaagagaagat
aagtctatagaagaagcaagtacaagtgagtttcttgctgggttgtggaggaagcaggag
cagaaggtcgatgatgggaaggaaaagtcagaagaaatatatctggaggatgatgaggaa
tga

DBGET integrated database retrieval system