KEGG   Sediminispirochaeta smaragdinae: Spirs_1483Help
Entry
Spirs_1483        CDS       T01287                                 

Definition
(GenBank) ABC transporter related protein
  KO
K13896  microcin C transport system ATP-binding protein
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm02010  ABC transporters
Module
ssm_M00349  Microcin C transport system
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spirs_1483
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssm02000]
    Spirs_1483
Transporters [BR:ssm02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    Spirs_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY AAA_16 SMC_N AAA_22 AAA_29 AAA_5 Mg_chelatase NACHT DUF87 AAA_25 Sigma54_activat Pox_A32 AAA_13 NB-ARC DUF2075 Myosin_head
Motif
Other DBs
NCBI-ProteinID: ADK80610
UniProt: E1R575
LinkDB All DBs
Position
complement(1587789..1589402)
Genome map
AA seq 537 aa AA seqDB search
MTSLLRIENVRIGFRRKERLRQVVHGIDLRLGEHESLAIVGESGSGKTVTAASILRLLGP
SAEYPSGKIYFREQELLRAPERTLLGVRGKEIGMIFQEPMSSLNPLQNIGRQVAESLFLH
GGTDSKQNRIRVVEMLRRVGLRNAETRLGAFPHQLSGGERQRVMIAMAIVNRPRLLIADE
PTTALDVTIQAQILDLLLDLKRELGMAMIFITHDLSIVGRIADRVVVMKEGKIVEEAETK
KLFASPTHPYTRLLIESEPAAAPPKRNTAPDERLLEIRNLKVHFPVKRGILKRTVDYIKA
VDGVSLSIPRGGSFGLVGESGSGKTSLGRALLRLIPSSGEIFLKGEPLHDLKGDELRPLR
RWMQPVFQDPFGTLSPRMCVTDIVGEGLRVHEKLSIPERQERVASALEEVGLDPGIGERY
PHEFSGGQRQRIALARALVLKPDLLVLDEPTSSLDRSIQFQVIELLLNIQAEHGLTYLFI
SHDLKVVRALCRSLGVMKQGVLVEQGDAEQVMKEPQQEYTRRLLETAFMLDQERRAT
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcgctgctacgcatagaaaacgtacggatcggctttcgccggaaagagcggctt
aggcaggtggtccatggcatcgatcttcggctcggagaacatgagagcctcgctatcgtc
ggagaaagcggatcgggaaaaacggttacggcagcatccatccttcgtcttttggggcct
tcggccgaatacccttccggaaagatctatttcagggagcaggagctgctccgcgcaccg
gaacggacactgctgggagtcaggggaaaagagatcggcatgattttccaggaaccgatg
tcgagcctcaatcccctccagaatatcggtaggcaggttgccgaaagcctcttcctccac
ggggggaccgacagcaagcaaaaccgcataagggttgttgaaatgctccgccgtgtcggc
ctcaggaatgcggaaacgcgacttggggcctttccccatcagctttcggggggagagcgg
cagcgagtgatgatcgccatggccattgtcaacaggcccaggcttttgattgccgatgag
ccgacaacagccctggatgtgacgatccaggcccagatcctcgacctgctccttgatctg
aagcgggagcttggaatggcaatgattttcatcacacacgacctctccatcgtcggaagg
attgccgacagggtcgtggttatgaaagagggaaagatcgtcgaagaggcggaaaccaag
aagcttttcgcctcccccacccatccctataccagactcctcatcgaatcagaaccagcg
gcagcccctccaaaacggaacacggcccccgacgagaggcttttggaaatcaggaatctt
aaggtccactttcccgtgaagcggggaatcctcaaaagaaccgtcgattatatcaaggcg
gtggacggcgtctctctttcgattccccgaggcggcagcttcgggctggtgggagaaagc
ggctcgggaaagaccagcctgggaagagcccttttgcgccttattcccagcagcggagag
atattcctgaagggagagccgctccacgacctcaaaggcgatgaacttcgcccccttcgc
agatggatgcagccggtctttcaggaccccttcggaaccctctctcccagaatgtgcgta
accgatattgtcggagagggtttacgtgtccatgaaaagctgagcatcccggaacgacaa
gaacgagttgcctccgccctggaagaggtggggctcgatccaggaatcggggagcgatat
ccccacgaattttccggaggacaacggcagcgcatcgcccttgccagagcccttgttctc
aagcccgatctcttggtgcttgatgaaccaacatcaagcctcgacaggtccattcagttt
caggttattgaattgcttttgaatatccaggccgaacatggacttacctatctcttcatc
agccacgacctcaaggtggtacgggccctttgtcgttctctcggcgtcatgaagcaggga
gtccttgtcgagcagggagatgccgaacaggtcatgaaagaaccacaacaggagtacacc
agaagattacttgaaacggcttttatgcttgaccaggaaagaagagccacatag

DBGET integrated database retrieval system