KEGG   Sediminispirochaeta smaragdinae: Spirs_3798Help
Entry
Spirs_3798        CDS       T01287                                 

Definition
(GenBank) adenylate/guanylate cyclase with Chase sensor
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00230  Purine metabolism
ssm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Spirs_3798
Enzymes [BR:ssm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Spirs_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE2 Guanylate_cyc TPR_2 DUF825
Motif
Other DBs
NCBI-ProteinID: ADK82884
UniProt: E1R829
LinkDB All DBs
Position
4091843..4094566
Genome map
AA seq 907 aa AA seqDB search
MRKNSVFRLYYLIPLIVAALVTSVMLLPQMQNGDRRIFDLFMHIKPAVKEDNSILLLDID
DLAIAQVGTWPWSRSVVADGLILLSEFDAEAAVFDIEYVDKSPLGIDSRYLEQKIPALFQ
ENFSVLGENVTAFFTALVNGDIPLNGAESYISDLKGINQQVMKLLLDAVRSVSRDNDAYL
GEALNFFGNGWITVNMLPNEVELAKVSDDLKSYVKEHVSLKNVRVEGTYAPSLQGPSVQP
AIMKLLSKAAGAGFPNVVVDNDGVRRRIDLLAEYDGKYFGQLAFVPLLKRLGNPQIIAKP
GSITLKGEKKSVTIPFDGKGRMLINWPPKIFDDSFRHLSYNNLVVHGRLEEQIVANLKIM
EEAGYLDFYKGQAPPMDLYRYAEQLKEDLLAEAGKEGIQDRSKVDEYREVRKQFFEECTA
LIAGDTERAIIGEIDRLLSSGQLNEEQKKEYEAIKVEVTDSFAAIATDISKLSEIRERLS
HELSGAFVIIGHTGISTTDIGVNPFAKEYMNVGTHAAVVNTILQEDFLRELPLSAGVAIA
LLFTLLLSLIIRRLSPLPSILVGIAFILGTFGAGLILFLSLGWYLPLLTPLLMISITFLS
ISLIKFLKTEGEKSFLRTAFGHYLSNEVINQLIAEPERLNLGGEKKRLTAMFTDIRGFST
ISEQLDPTELVTLLNNYLTGMSNIILEQFGTIDKYEGDAIIAFFGAPVDYQDHAWRACHS
AIRMKRVEKELNKRFLDEKMAPGPLMTRIGINTGEMVVGNMGTLQKMDYTIMGNAVNLAA
RLEGVNKRYGTWILISEETRKGFTEEFVVRKLDRVRVVGINTPVRLYELVEETSHIDDNI
GEGLELFDRGMNLFEAWNWEEAKNMFSRVLKMIPGDGPSLFFIDRAEKFMKTPPPKEWDG
VFNLTLK
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagaatagcgtctttcgactttactatcttattccgcttatcgttgccgccctg
gtaacatctgtgatgttactgccgcagatgcagaacggcgacaggcgcattttcgatctt
tttatgcatatcaaaccggctgtgaaagaggataattcgattttgctcctcgatatcgat
gatctcgccattgcccaggtgggaacctggccatggagcagaagcgtggtagcggacggg
ctgatccttctcagcgaattcgatgccgaagcggcggttttcgatatcgagtatgtagac
aaaagccccctgggaatcgactcccgctatctcgagcagaaaattcccgccctgtttcaa
gaaaacttctcggttctcggagaaaacgtcactgccttttttacggccctggtcaacggc
gatattcccctcaacggggctgaaagctatatttccgatctgaagggcatcaaccaacag
gtaatgaaactgctgctggatgcggttcgttccgtttcccgggacaacgacgcatacctc
ggcgaggctctcaactttttcgggaacggctggataacggtaaatatgctgcccaacgag
gttgagctggcaaaggtcagcgatgacctgaaaagctatgtgaaagagcatgtgagcctg
aaaaacgtccgtgtagaaggaacctatgccccctctttgcagggcccttcagtccagccg
gcgattatgaaacttctatcgaaggcggcaggggccggttttcccaatgttgtggttgac
aacgatggtgtacggcggagaatcgatctcttggcggaatatgatggaaagtatttcggt
cagctcgcctttgtccccctgctgaagcggcttgggaatccgcagatcatcgcgaagccg
ggaagcatcaccctcaagggggagaaaaaaagtgtcacgatcccctttgatggcaaggga
aggatgcttatcaattggccgccgaaaattttcgacgacagttttcgacatctctcctat
aacaacctggtggtacacggccgtctggaagagcagatcgttgcgaatctgaagattatg
gaagaggcaggatatctcgatttttacaagggccaggcgccccccatggatctttatcgc
tatgcggaacagctgaaggaagatctgctcgccgaagcgggcaaggagggtatacaagat
cgctcaaaggtcgacgaatatcgagaagttcgcaagcagttctttgaggaatgtacggcc
ctcatagccggagacacagagcgtgccatcataggtgaaatcgatcgactcctttcctcc
ggccagctgaacgaagagcagaagaaggaatacgaggcgatcaaggtggaagttacggac
tcctttgccgcaatagcgaccgatatttcaaagctatcggagatacgggagaggctttcg
cacgagctctcaggggccttcgtcatcatcggtcacaccggaatatcgaccaccgatatc
ggcgtaaacccctttgcgaaggagtatatgaacgtcggaacccacgcggccgtcgtcaat
acgattttgcaggaggactttctccgggaactgccgctttcggcaggagtggccatagca
ctgcttttcaccctgctgctttcccttatcatcagacgtctctcgccgctgccttccatt
ctcgtggggatcgccttcatacttggaaccttcggtgcggggctcatcctctttcttagc
ctcggttggtatcttccgctcctaacacccttgttgatgatttccatcaccttcctctcg
atttccctcatcaagtttttaaaaaccgagggcgagaagagctttttgcgaacagccttc
ggccattatctgtcgaacgaagtaatcaatcagctgattgccgaaccggaacggctcaac
ctcgggggagaaaagaaacgactcacagccatgttcaccgatatcagaggattttccacg
atcagcgaacagcttgatccgaccgaactggtaaccctgctcaacaattatctgaccggt
atgagcaatattattttggagcagttcggaaccattgacaaatacgaaggagacgccatc
attgcctttttcggagcgcctgtcgattatcaggaccatgcgtggagggcctgtcactcg
gcgatacggatgaagcgggtggaaaaggagttgaataaacgttttcttgatgagaagatg
gcccccggtccccttatgacgaggatcggcatcaacaccggagagatggttgtgggtaat
atggggaccctccagaaaatggactacaccatcatgggaaatgccgtaaaccttgccgcg
agactcgaaggggtaaacaaaagatacggtacatggatccttatcagcgaagaaacaaga
aagggattcacagaggaatttgtcgttcgtaaactcgacagggtgcgggtagtcggaata
aacaccccggtacgtctctacgaattggttgaagaaacaagccatatcgacgacaacata
ggggaagggcttgaactattcgacagggggatgaaccttttcgaggcctggaactgggaa
gaggctaaaaatatgttttcccgggttttgaagatgattccaggcgacggtccctccctc
ttttttatcgatcgtgcggagaaattcatgaagacgccaccgccgaaggagtgggacggg
gtctttaatcttaccctgaaataa

DBGET integrated database retrieval system