KEGG   Shigella sonnei Ss046: SSON_0161Help
Entry
SSON_0161         CDS       T00274                                 

Gene name
mrcB
Definition
(GenBank) peptidoglycan synthetase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSON_0161 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssn01003]
    SSON_0161 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssn01011]
    SSON_0161 (mrcB)
Enzymes [BR:ssn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SSON_0161 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SSON_0161 (mrcB)
Glycosyltransferases [BR:ssn01003]
 Polysaccharide
  Bacterial polysaccharide
   SSON_0161 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:ssn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SSON_0161 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: AAZ86954
ShiBASE_China: SSO0161
UniProt: Q3Z5K8
LinkDB All DBs
Position
178927..181461
Genome map
AA seq 844 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDGELYEMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctgctgttaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgtagccgtattgatggcaaggtctgg
caactgcccgcggcagtttatggccgaatggtcaaccttgaaccagatatgaccatcagc
aagaacgaaatggtgaagctgctggaggcaacacagtatcgtcaggtgtcgaaaatgacc
cgtcctggcgaatttaccgtgcaggccaacagcattgagatgatccgccgtccgtttgat
ttcccggacagcaaagaagggcaggtgcgtgcgcgtctgacctttgatggcgatcatctg
gcgacgatcgtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgc
ctgatcaccatgatctcttcgccaaacggtgagcagcgtctgtttgtgccgcgcagtggt
ttcccggacttgctggtggatactttgctggcgacagaagaccgtcatttctacgagcat
gatgggatcagtctctactccatcggacgtgcggtgctggcaaacctgaccgccggacgc
acggtgcagggagcgagtacgctgacgcaacagctggtgaaaaacctgttcctctccagc
gagcgttcttactggcgtaaagcgaacgaagcttacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgcttgcgagcttgtattactttggtcgcccggtagaa
gagctcagcctcgaccagcaggcgctgttagtcggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccgaaactggcgctggagcgacgtaatctggtgctgcgtttgcta
caacaacagcagattatcgatggtgaactgtatgaaatgctcagcgcgcgtcctctgggc
gtacagccgcgcggtggggtaatctctccacagccagcctttatgcaactggtgcgtcag
gagctgcaggcgaaattaggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaactgcaattgtggtcgtcgaccgcttt
agtggtgaagttcgtgcgatggtgggaggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctgacggct
ttaagccagccgaaaatctatcgcctgaacacgtggattgccgatgcgccaatcgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaacgatgaccgtcgttatagcgaaagc
ggcagagtgatgctggtggatgcgttgacccgttcgatgaacgtgccgacggtaaatctg
gggatggcgctggggctgcctgcagttacggagacctggatcaaactgggcgtgccgaaa
gatcagctgcatccggttccggcgatgctgctgggggcgttgaacttaacgccaatcgaa
gtggcgcaggcattccagaccatcgccagcggcggtaaccgtgcaccgctttctgcactg
cgttcggtaatcgcggaagatggcaaggtgctgtatcagagcttcccgcaggcagaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggtggtacaacgt
ggtacgggtcgtcaacttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcgggcattgacggcagcacggtgaccatc
acctgggtaggccgtgataacaaccagccgaccaaactgtatggtgccagcggggcaatg
tctatttatcagcgttatctggctaaccagacgccaacgccgctgaatcttgttccgcca
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggcatg
cgtgtcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagcgagatgcag
cagcagccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagccgcaacag
caacctgctcagcaagagcagaaagacagcgacggtgtagccggttggatcaaggatatg
tttggtagtaattaa

DBGET integrated database retrieval system