KEGG   Shigella sonnei Ss046: SSON_0175Help
Entry
SSON_0175         CDS       T00274                                 

Gene name
yaeG
Definition
(GenBank) conserved hypothetical protein
  KO
K02647  carbohydrate diacid regulator
Organism
ssn  Shigella sonnei Ss046
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssn03000]
    SSON_0175 (yaeG)
Transcription factors [BR:ssn03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SSON_0175 (yaeG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: AAZ86967
ShiBASE_China: SSO0175
UniProt: Q3Z5J5
LinkDB All DBs
Position
197365..198540
Genome map
AA seq 391 aa AA seqDB search
MHNGGLMAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLV
LSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAEM
MLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQPRVVAIVEVDSG
QLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQL
ITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPESRCYFYQDLMLPVL
LDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLATSKALFIHRNTLEYR
LNRISELTGLDLGNFDDRLLLYVALQLDEER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgcataacggaggacttatggctggctggcatcttgataccaaaatggcgcaggatatc
gtggcacgtaccatgcgcatcatcgataccaatatcaacgtaatggatgcccgcgggcga
attatcggcagcggcgatcgtgagcgtattggtgaattgcacgaaggtgcattgctggta
ctttcacagggacgagtcgtcgatatcgatgacgcggtagcacgtcatctgcacggtgtg
cggcaggggattaatctaccgttacggctggaaggtgaaattgtcggcgtaattggcctg
acaggtgaaccagagaatctgcgtaaatatggcgaactggtctgcatgacggctgaaatg
atgctggaacagtcgcggttgatgcacctgttggcgcaggatagccgtttgcgggaagaa
ctggtgatgaacctgattcaggctgaggagaatactcccgcacttactgaatgggcgcaa
cggctggggattgatctcaatcaaccgcgagtggtggctattgttgaggtcgacagcggt
cagcttggcgtggacagcgcaatggcggagttacaacaactgcaaaatgcgctgactacg
cccgagcgtaataatctggtggcaattgtttcgctgaccgaaatggtggtgttgaaaccg
gcgttgaactcttttgggcgctgggatgcagaagatcatcgtaagcgagttgaacaactg
attacccgcatgaaagagtacggccagctgcgttttcgcgtttcactgggcaactatttt
accggtcctggcagtattgcccgatcctatcgtacggcgaaaacgacgatggtggtgggt
aaacagcggatgccagaaagtcgctgctatttttatcaggatctgatgttacctgtgtta
ctcgacagtttgcgtggcgactggcaggccaacgaactggcgcgaccgctggcgcggctg
aaagcgatggacaataatggcttgctgcgacgaacgctggcggcgtggtttcgccacaat
gtgcaaccgctggctacgtcaaaggcgctgtttattcatcgtaatactctggagtatcgg
cttaatcgtatatcggaactgaccgggcttgatttgggtaattttgatgacaggttgctg
ctgtatgtggcgttacaactggatgaagagcggtag

DBGET integrated database retrieval system