KEGG   Shigella sonnei Ss046: SSON_2752Help
Entry
SSON_2752         CDS       T00274                                 

Gene name
aroF
Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01130  Biosynthesis of antibiotics
ssn01230  Biosynthesis of amino acids
ssn02024  Quorum sensing
Module
ssn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSON_2752 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SSON_2752 (aroF)
Enzymes [BR:ssn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SSON_2752 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AAZ89369
ShiBASE_China: SSO2752
UniProt: Q3YYP3
LinkDB All DBs
Position
complement(2907985..2909055)
Genome map
AA seq 356 aa AA seqDB search
MQKDALNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKTISDIIAGRDPRLLVVCG
PCSIHDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDV
EAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL
SMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKAP
NYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGL
MIESNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTARVA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacgcgctgaataacgtacatattaccgacgaacaggttttaatgactccg
gaacaactgaaggccgcttttccattgagcctgcaacaagaagcccagattgctgactcg
cgtaaaaccatttcagatattatcgccgggcgcgatcctcgtctgctggtagtttgtggt
ccttgttccattcatgatccggaaactgctctggaatatgctcgtcgatttaaagccctt
gccgcagaggtcagcgatagcctctatctggtaatgcgcgtctattttgaaaaaccccgt
accactgtcggctggaaagggttaattaacgatccccatatggatggctcttttgatgta
gaagccgggctgcagatcgcgcgtaaattgctgcttgagctggtgaatatgggactgcca
ctggcgacggaagcgttagatccgaatagcccgcaatacctgggcgatctgtttagctgg
tcagcaattggtgctcgtacaacggaatcgcaaactcaccgtgaaatggcctccgggctt
tccatgccggttggttttaaaaacggcaccgacggcagtctggcaacagcaattaacgct
atgcgcgccgccgcccagccgcaccgttttgttggcattaaccaggcagggcaggttgcg
ttgctacaaactcaggggaatccggacgggcatgtcatcctgcgcggtggtaaagcgccg
aactatagccctgcggatgttgcgcaatgtgaaaaagagatggaacaggcgggactgcgc
ccgtctctgatggtagattgcagccacggtaattccaataaagattatcgccgtcagcct
gcggtggcagaatccgtggttgctcaaatcaaagatggcaatcgctcaattattggtctg
atgatcgaaagtaatatccacgagggcaatcagtcttctgagcaaccgcgcagtgaaatg
aaatacggtgtatccgtaaccgatgcctgcattagctgggaaatgaccgatgccttgctg
cgtgaaattcatcaggatctgaacgggcagctgacggctcgcgtggcttaa

DBGET integrated database retrieval system