KEGG   Shigella sonnei Ss046: SSON_2806Help
Entry
SSON_2806         CDS       T00274                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase activity
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00250  Alanine, aspartate and glutamate metabolism
ssn00280  Valine, leucine and isoleucine degradation
ssn00310  Lysine degradation
ssn00410  beta-Alanine metabolism
ssn00640  Propanoate metabolism
ssn00650  Butanoate metabolism
ssn01100  Metabolic pathways
ssn01120  Microbial metabolism in diverse environments
Module
ssn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SSON_2806 (gabT)
   00650 Butanoate metabolism
    SSON_2806 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSON_2806 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SSON_2806 (gabT)
   00310 Lysine degradation
    SSON_2806 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SSON_2806 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssn01007]
    SSON_2806 (gabT)
Enzymes [BR:ssn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SSON_2806 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SSON_2806 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     SSON_2806 (gabT)
Amino acid related enzymes [BR:ssn01007]
 Aminotransferase (transaminase)
  Class III
   SSON_2806 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAZ89417
ShiBASE_China: SSO2806
UniProt: Q3YYJ5
LinkDB All DBs
Position
2952411..2953691
Genome map
AA seq 426 aa AA seqDB search
MNSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEHENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggtggccgcagtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgtcgccagcc
tttatgcagcgtttacgcgctctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgtggcg
ccggatcttaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggacgctgttgcaccgggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgttcgagcatgaaaatctg
ctgcaaaaagccaacgatctggggcagaagctaaaagacggattgctggcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system