KEGG   Shigella sonnei Ss046: SSON_4504Help
Entry
SSON_4504         CDS       T00274                                 

Gene name
yjjN
Definition
(GenBank) putative oxidoreductase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00053  Ascorbate and aldarate metabolism
ssn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SSON_4504 (yjjN)
Enzymes [BR:ssn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     SSON_4504 (yjjN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N AdoHcyase_NAD 2-Hacid_dh_C Pyr_redox_2 HI0933_like Sacchrp_dh_NADP Pyr_redox_3 FAD_binding_3 NAD_binding_7 TrkA_N Pyr_redox NAD_binding_8 FAD_binding_2 Shikimate_DH GIDA UDPG_MGDP_dh_N Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AAZ90977
ShiBASE_China: SSO4504
UniProt: Q3YU35
LinkDB All DBs
Position
4778809..4779846
Genome map
AA seq 345 aa AA seqDB search
MESRIMSTMNVLICQQPKELVWKQREIPIPGDNEALIKIKSVGICGTDIHAWGGNQPFFS
YPRVLGHEICGEIVGLGKNIADLKNGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVH
QDGGFSEYLSVPVANILPADGIDPQAAALIEPFAISAHAVRRAAIAPGEQVLVVGAGPIG
LGAAAIAKADGAQVVVADTSPARREHVATRLELPLLDPSAEDFDAQLRAQFGGSLAQKVI
DATGNQHAMNNTVNLIRHGGTVVFVGLFKGELQFSDPEFHKKETTMMGSRNATPEDFAKV
GRLMAEGKITADMMLTHRYPFATLAETYERDVINNRELIKGVITF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggagagccgaatcatgtctacgatgaatgttttaatttgccagcagccgaaagaatta
gtctggaaacaacgcgagatacctattccgggtgacaatgaagcattaataaaaattaag
tctgtcgggatttgcggtaccgatattcatgcctggggtggaaatcaaccattttttagt
tatccacgtgttttaggccatgaaatatgtggggagattgttgggctgggtaaaaatatt
gctgatcttaaaaatggtcagcaagttgctgtgatcccttatgttgcctgtcagcaatgc
ccggcgtgtaaaagcgggcgtaccaattgctgtgaaaaaatttcagtcattggcgtgcat
caggatggcggttttagtgagtatttgagcgtgccggtggcgaacattttgcccgcagac
ggtattgacccgcaggcggcagcattgattgaacctttcgctattagcgctcatgcggtg
cgtcgcgcagccattgctcccggcgagcaggtgctggtggtcggggcggggccaatcggt
ctgggcgcggcggcaatcgctaaagccgatggcgcacaggtggtggtggcggataccagt
ccggcgcgccgtgaacatgtggcaacgcgtctggaattacctttactggacccgtcagcc
gaagattttgacgcgcagctacgggcgcagtttggtggttcgctggcgcagaaagtgatc
gacgcgacaggtaatcaacatgcgatgaataacaccgtgaatttgattcgtcacggcggc
acggtggtatttgtcggcctgtttaaaggtgagttgcagttctccgatccggaattccat
aaaaaagaaacgacgatgatgggtagccgcaacgccacgccggaagattttgctaaagtc
ggtcgactgatggcggaaggaaaaatcactgctgacatgatgttaacccatcgctatccg
ttcgccacgctggcagaaacctacgagcgcgatgtgattaacaatcgtgagttgattaag
ggtgtaattactttctga

DBGET integrated database retrieval system