KEGG   Sulfolobus solfataricus SULA: SULA_0070Help
Entry
SULA_0070         CDS       T03910                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssoa  Sulfolobus solfataricus SULA
Pathway
ssoa00620  Pyruvate metabolism
ssoa00680  Methane metabolism
ssoa00720  Carbon fixation pathways in prokaryotes
ssoa01100  Metabolic pathways
ssoa01120  Microbial metabolism in diverse environments
ssoa01200  Carbon metabolism
Module
ssoa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ssoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SULA_0070
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULA_0070
   00680 Methane metabolism
    SULA_0070
Enzymes [BR:ssoa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SULA_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA77915
UniProt: A0A0E3JSM4
LinkDB All DBs
Position
64400..65935
Genome map
AA seq 511 aa AA seqDB search
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDLFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITIPVFEVILPMTTSSLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEV
IPLVEDRDSLQNINNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRISPARILEKYEEDVLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFLNWESFKLIKDIWKISEDTIAKIKEDIDYAESVIGIKLGGIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcataccacgcactatgtcaacacaacatcccgataatgcaaaagtaccagag
tgggcaaaaagcgaagttattgaaggagaagacgaagttaaagaagccttcctagcttat
agtatgtatggagttcatgaggtaatgtgggatgctgagggaaaagatgtagatactcat
gtggtaagaaagttattgtcaaattatccagactactttagagaacatattttaggtaaa
gatctgtttctaacttataggttacctaacccaaaggtggaaggtgctgatagaaaagtt
tttgccgaaaccatggagagtattccaataacttatgatttggcagagaaattttacggt
aatgggattacgataccagtttttgaagtaattttaccaatgacaactagtagtttagag
ataataagtgtggctaggtattacgaaaaggcagttgcaaatgaagatgaactagaactt
tacgatggtgtaaaagtaaaggatttagttggagaaatatatcctaaagtaatagaagtt
ataccactagtcgaagatagggactctcttcaaaatattaacaatatagtggaggggtat
tataaggtaattaaacctaagtatatgagagtctttttagccagatcggatccagcaatg
aattatggaatgataacagctgttctgtcagtaaagattgccttaagcgagttatacaaa
ctttcagaatcgttaaactttgaaatatatccaataattggtgttggttcacttccattt
agaggtcatttatctcctgaaaactatgaaaaagtattggaagagtataagggagtttat
acatatacgattcaatcagcgtttaagtatgactatgattacgacaaagtaaaaagtgct
atttcttcaataaataactcaaggattagcccagctagaatattggaaaagtatgaggag
gatgttctaagaaagataacgatcttatatactgaacgttaccagccaattatagaaagt
cttgcaaacgctataaatgacgtctccgtgttacttcctagaagaagggccagaaaactt
catattggtctttttggatattctagaagcgcaggcaaggttagcttacctagggcaatc
tctttcgtgggttcattatattcaataggaataccaccagaactaataggaatttcgtct
ttaagcaatttagatgagaaagaatgggatatattcaaacagaattacgttaattttaaa
catgatctacaaactgctgcgagattccttaattgggagtcgttcaaattaattaaggat
atatggaaaattagtgaggatactatagcaaagatcaaggaagatatcgattacgctgag
agcgtgataggcataaaattaggcggcatagattacgatagtagaaaacacatcctaatg
tcttcgctatttttactatcatttaaagagaaaatacttcaagaatctaagaagtattta
tatgagatggcattaattagaagatccttgggatga

DBGET integrated database retrieval system