KEGG   Sulfolobus solfataricus SULA: SULA_0895Help
Entry
SULA_0895         CDS       T03910                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ssoa  Sulfolobus solfataricus SULA
Pathway
ssoa00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ssoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SULA_0895
   00053 Ascorbate and aldarate metabolism
    SULA_0895
Enzymes [BR:ssoa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     SULA_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKA78641
UniProt: A0A0E3JWV7
LinkDB All DBs
Position
complement(859489..860925)
Genome map
AA seq 478 aa AA seqDB search
MKSYQGLADKWIKGSGEEYLDINPADKDHVLAKIRLYTKDDVKEAINKAVAKFDEWSRTP
APKRGSILLKAGELMEQEAQEFALLMTLEEGKTLKDSMFEVTRSYNLLKFYGALAFKISG
KTLPSADPNTRIFTVKEPLGVVALITPWNFPLSIPVWKLAPALAAGNTAVIKPATKTPLM
VAKLVEVLSKAGLPEGVVNLVVGKGSEVGDTIVSDDNIAAVSFTGSTEVGKRIYKLVGNK
NRMTRIQLELGGKNALYVDKSADLTLAAELAVRGGFGLTGQSCTATSRLIINKDVYTQFK
QRLLERVKKWRVGPGTEDVDMGPVVDEGQFKKDLEYIEYGKNVGAKLIYGGNIIPGKGYF
LEPTIFEGVTSDMRLFKEEIFGPVLSVTEAKDLDEAIRLVNAVDYGHTAGIVASDIKAIN
EFVSRVEAGVIKVNKPTVGLELQAPFGGFKNSGATTWKEMGEDALEFYLKEKTVYEGW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtatcagggattggctgacaagtggattaagggcagtggggaagaatacctt
gatattaatccggctgataaggatcacgtattagctaagataagattatatacaaaagat
gacgttaaagaagctataaacaaggctgtagccaaattcgacgaatggtcaaggactcca
gcacctaaaagaggctcaatattacttaaggcaggggaattaatggaacaagaagcccaa
gagtttgcgctattgatgacattagaggagggtaagactctcaaggatagtatgtttgaa
gtgacaagaagttataatttactgaaattttatggagcattagcatttaagatatctggg
aaaacgcttccttcagcagatcctaatactaggatatttacagtaaaggaacccttaggc
gtagtagctttaattacgccgtggaatttcccattatcaataccagtatggaaattggct
ccagccttggctgcgggtaacactgcagtaataaaaccagcgacgaaaacaccgttaatg
gtagccaaattggtagaagtgttgtctaaagctggattgccagagggtgtcgtgaattta
gtagttggtaagggaagtgaagtcggagataccatagtaagtgatgataatatagctgca
gtatcatttactggatcaaccgaggtaggtaagagaatttacaaactcgtaggaaataaa
aatagaatgacaagaattcaactagagctaggaggtaaaaacgcgttatatgtggataag
agcgctgacttaacgttagctgctgaattagccgtaagaggaggatttggactaaccggt
caatcatgtactgcaactagtaggttaataattaacaaggatgtatatactcaatttaaa
caaagactactagaaagagttaagaagtggagagtaggaccgggtactgaagatgttgat
atgggtccagttgtagatgaaggtcaatttaagaaagacttagaatatatagaatacgga
aagaatgtgggagcaaaactaatttatggtggaaatataataccagggaagggatatttc
ctagaacctacaattttcgaaggagtcacatctgatatgaggctatttaaagaagagatt
ttcggtccagtacttagtgtcactgaggcaaaagatttagatgaggctataaggctagtt
aacgctgtagactatggacatacagctggaatagtcgcaagcgatatcaaggcgattaac
gagttcgttagtagggtagaggcaggagttataaaggttaataagccaacagtcggactg
gaattgcaagcaccatttggtggttttaagaattctggagccactacgtggaaagagatg
ggagaagatgctttagagttctaccttaaggagaagacagtatacgaaggctggtaa

DBGET integrated database retrieval system