KEGG   Sulfolobus solfataricus SULA: SULA_1998Help
Entry
SULA_1998         CDS       T03910                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
ssoa  Sulfolobus solfataricus SULA
Pathway
ssoa00500  Starch and sucrose metabolism
ssoa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SULA_1998
Enzymes [BR:ssoa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SULA_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AKA79602
UniProt: A0A0E3KD16
LinkDB All DBs
Position
complement(1809074..1810417)
Genome map
AA seq 447 aa AA seqDB search
MKRVIVGFEVHQPFRIRRDFFWNPRFRQKLEDRFFDTERNKEIFERIKKNCYIPATNIIL
SSIERAEEEGNNVKYFFSISGTFLEQAERWGREVIELFQQLAYTHKVEFLAQTYYHSVTS
LWEDKSEWKEQVKMHKDTIKSYFGQYPTTFENTELITKKDIVEEVEKMGFKMMLSEGTNR
NLNGRSPNYVYKLKGHEIRMLFRNYTLSDDIAFRFSNPNWDQYPLTASKYADWISRSEGN
VGLIFVDYETFGEHHREQTGILEFLKWLPIELNSKGVEMMMPKEVYNDVYDEIEIAHTTS
WADIEKDEKSWLGNIMQWAYDDAVRRAEMPSRELGNEYLRVWRYFTTSDNYYYLYLGHGS
PAEVHSYFNAFGSPIDAFINEFYAISTFIHEEISKLNIKNEPYIFILGDKRASIAWNEKE
FMEIVMRDERFKTHLKNLRLWLGNEKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaatagtaggatttgaagttcaccaaccattcaggattagaagagatttc
ttctggaacccgcgatttagacaaaagctagaggatagatttttcgatactgagagaaat
aaagagatatttgagagaataaagaagaactgctacatccctgcaacaaacataatacta
agctctattgaaagagccgaagaagaaggaaataacgttaaatacttcttttcaatttca
gggactttcttagagcaagcggagagatggggaagagaggtaatagaattatttcaacaa
ttggcatatacacataaagttgaatttctagcgcaaacctattatcattctgtaaccagc
ctttgggaggataaaagtgaatggaaagagcaagttaagatgcataaggatacgataaag
tcttattttggacaatatcctaccacttttgaaaatactgaattaattactaaaaaggat
attgtagaagaagttgaaaaaatgggctttaagatgatgttaagtgagggaactaataga
aatttaaatggacgaagtccaaattacgtctataaattgaagggacatgagattagaatg
ttgtttaggaattatacgttaagtgatgatatagccttcagattttctaatccaaattgg
gatcaatatccgttaacagcttccaagtatgctgattggataagtagaagtgagggaaat
gtaggattaatattcgtagattacgagacttttggagaacaccacagagaacaaactgga
attttagaatttcttaaatggttaccaatagagcttaacagtaaaggagttgaaatgatg
atgccaaaggaagtttacaatgacgtctatgatgaaatagaaattgctcatactacctcg
tgggctgatatagaaaaagatgagaaaagttggttgggaaatataatgcaatgggcttac
gatgatgcggttagaagggctgagatgccctcaagggaattgggtaatgagtatttaagg
gtctggagatattttactacaagcgataattactattatctttatttagggcatgggagt
ccagctgaagtacattcctattttaacgcctttggatcccctatagatgcgtttataaat
gaattttatgcaatatcgacatttatacatgaagaaataagtaaattaaatattaagaat
gagccttatatattcatattaggagataagagagcgtcgatagcttggaatgaaaaagag
ttcatggaaattgtaatgagagatgaaaggtttaaaactcatttgaaaaacttaaggctg
tggttaggaaatgaaaaggattga

DBGET integrated database retrieval system