KEGG   Streptococcus sobrinus: DK181_02210Help
Entry
DK181_02210       CDS       T05567                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssob  Streptococcus sobrinus
Pathway
ssob00220  Arginine biosynthesis
ssob00250  Alanine, aspartate and glutamate metabolism
ssob00290  Valine, leucine and isoleucine biosynthesis
ssob01100  Metabolic pathways
ssob01110  Biosynthesis of secondary metabolites
ssob01130  Biosynthesis of antibiotics
ssob01210  2-Oxocarboxylic acid metabolism
ssob01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DK181_02210
   00290 Valine, leucine and isoleucine biosynthesis
    DK181_02210
   00220 Arginine biosynthesis
    DK181_02210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssob01007]
    DK181_02210
Enzymes [BR:ssob01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DK181_02210
    2.6.1.66  valine---pyruvate transaminase
     DK181_02210
Amino acid related enzymes [BR:ssob01007]
 Aminotransferase (transaminase)
  Class I
   DK181_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Alliinase_C Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AWN18318
LinkDB All DBs
Position
414594..415808
Genome map
AA seq 404 aa AA seqDB search
MKQFDKSTKLEHVAYDIRGPVLDEANRMLANGEKILRLNTGNPAAFGFTAPDEVIRDLIL
NVRDSEGYSDSKGIFSARKAIMQYCQTKGFPPVDIDDIYIGNGVSELISMSLQALLNDGD
EVLVPMPDYPLWTACVSLSGGKAVHYLCDEQAEWYPDLDDIKSKITSNTKAIVVINPNNP
TGALYPNDILESIVEIARQNDLVIFADEIYDRLVMDGAKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCANVLAQHVVQTSLGGYQSGDELL
IPGGRIYEQREFITKAINDIPGLSAVKPKAGLYIFPKIDQNMYKVDDDEEFVLRLLKQEK
VMLVPGKGFNWNKPDHFRIVYLPRVEELAEVQEKITRVLAQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttgataaatcaactaaacttgaacacgtggcctacgatattcgcggtcca
gttcttgatgaggccaatcgcatgctagccaatggtgagaaaatcctccgtctcaataca
ggaaacccagcagcctttggtttcacagcacctgacgaagttattcgagacctgatttta
aatgttagagacagtgaaggctattccgattctaaaggaatcttctcagctcgaaaagcc
atcatgcagtactgtcagaccaagggctttccaccagttgatattgatgacatctatatc
ggtaatggggtgtcagaattaatttccatgtccctacaggccttgctcaatgatggtgat
gaggtcttggtgccaatgcctgactatcctctttggaccgcctgtgttagtttgtcagga
ggtaaggctgtccactatctttgcgatgaacaggctgaatggtatcctgatcttgacgat
atcaagtctaaaattacttccaatactaaggctatcgtggttatcaatccaaataatcca
acaggagccctctatccaaatgatattctggaaagtattgtagaaattgctcggcagaat
gatttggtcatctttgctgatgaaatctacgatcgtctggttatggatggtgccaagcat
acagccatcgctagtctggctcctgatgtcttttgtgtctccatgaatggtctctccaaa
tcccatcgtatctgtggtttccgagttggttggatggttctctcaggtcctaagacccat
gtgaaaggctatattgaagggctcaatatgctctctaatatgcgactctgtgcgaatgtt
ttggcccaacatgttgtccagacttctctgggtggctaccagtcgggggatgaactctta
attcccggtggtcgaatctacgagcaaagggaatttattaccaaggctatcaatgatatt
ccgggtctgtcagccgtcaaacccaaggcaggtctctatattttccctaagattgaccag
aatatgtataaggttgacgacgatgaagaatttgtcctgcgattactcaagcaggagaaa
gttatgttggttcctggcaagggcttcaactggaataagcctgatcattttagaattgtt
tatctgccacgtgtggaggaactagcagaggttcaagaaaagattacccgagttctagct
caatataagcgttaa

DBGET integrated database retrieval system