KEGG   Streptococcus sobrinus: DK181_06740Help
Entry
DK181_06740       CDS       T05567                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
ssob  Streptococcus sobrinus
Pathway
ssob00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssob01100  Metabolic pathways
ssob01110  Biosynthesis of secondary metabolites
ssob01130  Biosynthesis of antibiotics
ssob01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DK181_06740
Enzymes [BR:ssob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     DK181_06740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT
Motif
Other DBs
NCBI-ProteinID: AWN19144
LinkDB All DBs
Position
complement(1373362..1374186)
Genome map
AA seq 274 aa AA seqDB search
MKIAYLGPSGSFTHNAALKAFLGQDLVPYANITDVIKAYENAQVDFAIIPVENSIEGSVH
ETLDYLFHQADIKAVAEVVQPIQQQLMVCQADRKIEKIFSHPQALAQGKAYIDQHYPDAK
VEVTASTAYAARYVAEHPDQPFAAIAPRMAAREYGLTIIAQDIQEIDENYTRFWVLGKRT
PELPLPVQTSKISLALTLPDNLPGALYKAMSVFAWRSIDMTKIESRPLKTMLGEYFFIID
LDNQARDLVAFALEELKTLGIDYKILGQYQVYSI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcctatctgggtcctagtggctcttttacccataacgccgccctcaaggct
tttcttggacaagacctagtaccttatgccaatattactgatgttattaaggcctatgaa
aatgcccaggttgatttcgctataattccggtggaaaattctattgagggttcggttcat
gaaactctagactatctctttcatcaggccgatattaaggcggtggcagaagtggttcaa
cctattcaacaacagcttatggtctgtcaggcggataggaaaattgaaaaaatcttttcg
catccccaggctctggctcaaggcaaggcctatatagaccagcattatccagatgctaag
gttgaggtgacagctagtacggcttatgctgctcgctatgtcgcagagcacccagaccag
ccttttgccgccattgcacccagaatggctgctagggaatatggcctaaccatcattgct
caggatattcaagaaattgatgaaaactacacccgcttttgggttctagggaaaaggacg
ccagaattgcccctaccagtccagaccagcaagatttccctggctctcaccctgccagat
aatttaccaggggccctctacaaggccatgtccgttttcgcttggcgaagcattgatatg
accaagattgaaagtcggcccctcaagaccatgctgggtgagtatttcttcatcattgat
ttggataatcaggcaagggatttggttgcctttgccttggaagagctcaagactttgggc
attgactataaaattttgggccaataccaggtctattcgatatag

DBGET integrated database retrieval system