KEGG   Streptococcus sobrinus: DK181_07160
Entry
DK181_07160       CDS       T05567                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssob  Streptococcus sobrinus
Pathway
ssob00010  Glycolysis / Gluconeogenesis
ssob00020  Citrate cycle (TCA cycle)
ssob00620  Pyruvate metabolism
ssob01100  Metabolic pathways
ssob01110  Biosynthesis of secondary metabolites
ssob01120  Microbial metabolism in diverse environments
ssob01200  Carbon metabolism
Module
ssob_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK181_07160
   00020 Citrate cycle (TCA cycle)
    DK181_07160
   00620 Pyruvate metabolism
    DK181_07160
Enzymes [BR:ssob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DK181_07160
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Other DBs
NCBI-ProteinID: AWN19225
LinkDB
Position
complement(1478348..1479745)
AA seq 465 aa
MAVEIIMPKLGVDMSEGEIIEWKKQEGDRVNQGDILLEIMSDKTNMELEAEESGILLKIV
HPAGDTVPVTEVIGYIGEEGEVIEDIVEKSNPAENKGQTVANTDSPVQGTAAPLAANQTE
PTSEPQGNGGKVRATPAARKMARDLGIDLGRVSGTGPKGRVHKDDVEQFQAAQPKATPLA
RKMALDFGLDLGQIKGSGIFGKITKEDILAVGQPKASQEAEEVAPKAAPLAEGVEVKPMS
AMRKAIAKGMTNSYLTAPTFTLNYDIDMTNLMALRKQLIDPIMDKTGLKVTFTDLIGLAV
VKTLTKPEHEYLNASLINDAKDIELHRFVNLGIAVGLDEGLIVPVVHGVDQMNLSEFVVA
SKELIKKAQTGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVCATVQTPTAV
DGQITIRPIMQLCLTIDHRIVDGMNGAKFMVDLKHILENPMELLI
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcagtagaaatcattatgcccaagctcggtgtggacatgtcggaaggcgaaatcatc
gagtggaaaaagcaggaaggcgacagggtcaatcaaggggacatcctgctagaaatcatg
tctgacaaaaccaatatggagctggaagctgaggagtcaggaatactgttgaagattgtc
catccagctggcgataccgttcctgttaccgaggtcattggttatatcggagaggagggt
gaagtcattgaagacattgtggagaagtcaaatccagcagaaaacaagggacagacggta
gcaaatactgacagtcccgttcaaggtactgcagcaccactagcagccaaccaaactgaa
ccaacttctgaaccccaaggaaatggcggcaaggttcgtgctactccagcagctcgtaaa
atggcccgtgatttaggtattgacttgggccgagtctctggaacaggacccaaggggcgt
gttcataaggacgatgtagaacagttccaagcagctcaacctaaggctacccctctggct
cgtaaaatggcccttgattttggccttgatttgggtcagattaagggaagtggtatcttt
ggcaagattaccaaggaagacatcttggcggtcggtcaacctaaggccagccaagaagca
gaagaggtggctccaaaagcagctcctctggcagaaggtgtggaagtcaaaccaatgtcg
gctatgcgtaaggcaattgccaagggcatgaccaactcctatctgaccgcaccaaccttt
accctcaattatgatattgatatgactaatctgatggccttacgcaagcaattgatcgat
cctattatggataagacgggtctcaaggtgacttttacagatctgattggtttagctgtt
gttaaaaccttgaccaagcccgaacacgagtaccttaatgcttcccttatcaacgacgcc
aaagatatcgagttgcatcgttttgtcaatctaggaatagccgttggtctggatgaaggc
ttgattgtgcctgttgttcatggtgttgatcagatgaatctgtcggaatttgttgtggca
tctaaggagcttataaaaaaggctcagactggtaaattaaaggcagctgagatgtcaggc
tctactttctctatcactaatctagggatgtttggcactaagtccttcaatccgattatc
aatcagcctaactcagccatcttgggagtctgtgcgacggttcaaacgccgacggctgtt
gatggtcaaatcaccattcgaccaatcatgcagctctgtttgaccattgaccatcggatc
gttgatggcatgaatggggctaaatttatggttgatctcaagcatattttagaaaatcca
atggaattgttaatttaa

DBGET integrated database retrieval system