KEGG   Streptococcus sobrinus: DK181_07160Help
Entry
DK181_07160       CDS       T05567                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssob  Streptococcus sobrinus
Pathway
ssob00010  Glycolysis / Gluconeogenesis
ssob00020  Citrate cycle (TCA cycle)
ssob00620  Pyruvate metabolism
ssob01100  Metabolic pathways
ssob01110  Biosynthesis of secondary metabolites
ssob01120  Microbial metabolism in diverse environments
ssob01130  Biosynthesis of antibiotics
ssob01200  Carbon metabolism
Module
ssob_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK181_07160
   00020 Citrate cycle (TCA cycle)
    DK181_07160
   00620 Pyruvate metabolism
    DK181_07160
Enzymes [BR:ssob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DK181_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AWN19225
LinkDB All DBs
Position
complement(1478348..1479745)
Genome map
AA seq 465 aa AA seqDB search
MAVEIIMPKLGVDMSEGEIIEWKKQEGDRVNQGDILLEIMSDKTNMELEAEESGILLKIV
HPAGDTVPVTEVIGYIGEEGEVIEDIVEKSNPAENKGQTVANTDSPVQGTAAPLAANQTE
PTSEPQGNGGKVRATPAARKMARDLGIDLGRVSGTGPKGRVHKDDVEQFQAAQPKATPLA
RKMALDFGLDLGQIKGSGIFGKITKEDILAVGQPKASQEAEEVAPKAAPLAEGVEVKPMS
AMRKAIAKGMTNSYLTAPTFTLNYDIDMTNLMALRKQLIDPIMDKTGLKVTFTDLIGLAV
VKTLTKPEHEYLNASLINDAKDIELHRFVNLGIAVGLDEGLIVPVVHGVDQMNLSEFVVA
SKELIKKAQTGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVCATVQTPTAV
DGQITIRPIMQLCLTIDHRIVDGMNGAKFMVDLKHILENPMELLI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaaatcattatgcccaagctcggtgtggacatgtcggaaggcgaaatcatc
gagtggaaaaagcaggaaggcgacagggtcaatcaaggggacatcctgctagaaatcatg
tctgacaaaaccaatatggagctggaagctgaggagtcaggaatactgttgaagattgtc
catccagctggcgataccgttcctgttaccgaggtcattggttatatcggagaggagggt
gaagtcattgaagacattgtggagaagtcaaatccagcagaaaacaagggacagacggta
gcaaatactgacagtcccgttcaaggtactgcagcaccactagcagccaaccaaactgaa
ccaacttctgaaccccaaggaaatggcggcaaggttcgtgctactccagcagctcgtaaa
atggcccgtgatttaggtattgacttgggccgagtctctggaacaggacccaaggggcgt
gttcataaggacgatgtagaacagttccaagcagctcaacctaaggctacccctctggct
cgtaaaatggcccttgattttggccttgatttgggtcagattaagggaagtggtatcttt
ggcaagattaccaaggaagacatcttggcggtcggtcaacctaaggccagccaagaagca
gaagaggtggctccaaaagcagctcctctggcagaaggtgtggaagtcaaaccaatgtcg
gctatgcgtaaggcaattgccaagggcatgaccaactcctatctgaccgcaccaaccttt
accctcaattatgatattgatatgactaatctgatggccttacgcaagcaattgatcgat
cctattatggataagacgggtctcaaggtgacttttacagatctgattggtttagctgtt
gttaaaaccttgaccaagcccgaacacgagtaccttaatgcttcccttatcaacgacgcc
aaagatatcgagttgcatcgttttgtcaatctaggaatagccgttggtctggatgaaggc
ttgattgtgcctgttgttcatggtgttgatcagatgaatctgtcggaatttgttgtggca
tctaaggagcttataaaaaaggctcagactggtaaattaaaggcagctgagatgtcaggc
tctactttctctatcactaatctagggatgtttggcactaagtccttcaatccgattatc
aatcagcctaactcagccatcttgggagtctgtgcgacggttcaaacgccgacggctgtt
gatggtcaaatcaccattcgaccaatcatgcagctctgtttgaccattgaccatcggatc
gttgatggcatgaatggggctaaatttatggttgatctcaagcatattttagaaaatcca
atggaattgttaatttaa

DBGET integrated database retrieval system