KEGG   Sulfolobus solfataricus SULB: SULB_0071Help
Entry
SULB_0071         CDS       T03911                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssol  Sulfolobus solfataricus SULB
Pathway
ssol00620  Pyruvate metabolism
ssol00680  Methane metabolism
ssol00720  Carbon fixation pathways in prokaryotes
ssol01100  Metabolic pathways
ssol01120  Microbial metabolism in diverse environments
ssol01200  Carbon metabolism
Module
ssol_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ssol00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SULB_0071
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULB_0071
   00680 Methane metabolism
    SULB_0071
Enzymes [BR:ssol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SULB_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA72523
UniProt: A0A0E3JSM4
LinkDB All DBs
Position
64400..65935
Genome map
AA seq 511 aa AA seqDB search
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDLFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITIPVFEVILPMTTSSLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEV
IPLVEDRDSLQNINNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRISPARILEKYEEDVLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFLNWESFKLIKDIWKISEDTIAKIKEDIDYAESVIGIKLGGIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcataccacgcactatgtcaacacaacatcccgataatgcaaaagtaccagag
tgggcaaaaagcgaagttattgaaggagaagacgaagttaaagaagccttcctagcttat
agtatgtatggagttcatgaggtaatgtgggatgctgagggaaaagatgtagatactcat
gtggtaagaaagttattgtcaaattatccagactactttagagaacatattttaggtaaa
gatctgtttctaacttataggttacctaacccaaaggtggaaggtgctgatagaaaagtt
tttgccgaaaccatggagagtattccaataacttatgatttggcagagaaattttacggt
aatgggattacgataccagtttttgaagtaattttaccaatgacaactagtagtttagag
ataataagtgtggctaggtattacgaaaaggcagttgcaaatgaagatgaactagaactt
tacgatggtgtaaaagtaaaggatttagttggagaaatatatcctaaagtaatagaagtt
ataccactagtcgaagatagggactctcttcaaaatattaacaatatagtggaggggtat
tataaggtaattaaacctaagtatatgagagtctttttagccagatcggatccagcaatg
aattatggaatgataacagctgttctgtcagtaaagattgccttaagcgagttatacaaa
ctttcagaatcgttaaactttgaaatatatccaataattggtgttggttcacttccattt
agaggtcatttatctcctgaaaactatgaaaaagtattggaagagtataagggagtttat
acatatacgattcaatcagcgtttaagtatgactatgattacgacaaagtaaaaagtgct
atttcttcaataaataactcaaggattagcccagctagaatattggaaaagtatgaggag
gatgttctaagaaagataacgatcttatatactgaacgttaccagccaattatagaaagt
cttgcaaacgctataaatgacgtctccgtgttacttcctagaagaagggccagaaaactt
catattggtctttttggatattctagaagcgcaggcaaggttagcttacctagggcaatc
tctttcgtgggttcattatattcaataggaataccaccagaactaataggaatttcgtct
ttaagcaatttagatgagaaagaatgggatatattcaaacagaattacgttaattttaaa
catgatctacaaactgctgcgagattccttaattgggagtcgttcaaattaattaaggat
atatggaaaattagtgaggatactatagcaaagatcaaggaagatatcgattacgctgag
agcgtgataggcataaaattaggcggcatagattacgatagtagaaaacacatcctaatg
tcttcgctatttttactatcatttaaagagaaaatacttcaagaatctaagaagtattta
tatgagatggcattaattagaagatccttgggatga

DBGET integrated database retrieval system