KEGG   Saccharolobus solfataricus SARC-B: SULB_1221Help
Entry
SULB_1221         CDS       T03911                                 

Definition
(GenBank) D-arabino 3-hexulose 6-phosphate aldehyde lyase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
ssol  Saccharolobus solfataricus SARC-B
Pathway
ssol00030  Pentose phosphate pathway
ssol00680  Methane metabolism
ssol01100  Metabolic pathways
ssol01120  Microbial metabolism in diverse environments
ssol01200  Carbon metabolism
ssol01230  Biosynthesis of amino acids
Module
ssol_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ssol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SULB_1221
  09102 Energy metabolism
   00680 Methane metabolism
    SULB_1221
Enzymes [BR:ssol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     SULB_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase NanE QRPTase_C PEP_hydrolase 4HFCP_synth
Motif
Other DBs
NCBI-ProteinID: AKA73529
UniProt: A0A0E3JTR1
LinkDB All DBs
Position
1161469..1162146
Genome map
AA seq 225 aa AA seqDB search
MREVLLEKLRTEKFLQIALDFIDINDAIKVVNEVKDLENEIIEIGTPLLKSFGIEGIRKI
KSLVPDKIIVADTKTADAGDVEVEIAKLGGAHIMTVLGIMDDSTIYSAVKKARELDILVQ
ADLINVKNVYERSKELKQLGVDIIGFHVGLDVQKSRGISVADLKNEIRKVSELNLIISIA
GGLNKDRILELIDLPVSIYVVGGAITRSKEPKNVSKEIVNILKGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtactacttgaaaaacttcgtactgaaaaatttttacagatagctttagat
tttatagatatcaatgatgcaataaaagtggttaatgaagtcaaagatctagaaaatgaa
atcattgaaataggaacaccactactaaaatcattcgggatagaaggaataagaaaaata
aaatcattagttccagataaaataattgtagctgatactaaaactgcagatgcaggagat
gttgaggttgaaatagctaaactaggcggagctcatataatgacggttttaggaataatg
gatgattcaactatttattcagctgtaaaaaaagctagggaattagatatactagtccaa
gctgacttaattaatgttaaaaacgtatatgaaagatcaaaggagcttaagcaattagga
gtagatattataggtttccatgttggtttagatgtacaaaagagtagaggcataagtgta
gctgatttaaagaatgagatacgaaaggtgtctgagctaaacttaataatatcaatagct
ggaggcttaaataaagatagaattttagaactcatagatctgccagtaagcatatatgta
gtaggaggagcgataactagaagtaaagagcctaagaacgtatctaaagagatagttaac
atattaaagggtagataa

DBGET integrated database retrieval system