KEGG   Saccharolobus solfataricus SARC-B: SULB_2394Help
Entry
SULB_2394         CDS       T03911                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssol  Saccharolobus solfataricus SARC-B
Pathway
ssol00010  Glycolysis / Gluconeogenesis
ssol00020  Citrate cycle (TCA cycle)
ssol00620  Pyruvate metabolism
ssol01100  Metabolic pathways
ssol01110  Biosynthesis of secondary metabolites
ssol01120  Microbial metabolism in diverse environments
ssol01130  Biosynthesis of antibiotics
ssol01200  Carbon metabolism
Module
ssol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULB_2394
   00020 Citrate cycle (TCA cycle)
    SULB_2394
   00620 Pyruvate metabolism
    SULB_2394
Enzymes [BR:ssol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SULB_2394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 CAT GCV_H RnfC_N Transferase DUF2118 Peptidase_M23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AKA74545
UniProt: A0A0E3KDH3
LinkDB All DBs
Position
2222266..2223450
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTTVKSPVSGILLKIY
AKEGEEVPVGQIIAYIGEIGEQPPPSPTKPALATQQQQAQPIRTEEVKVIGEVRASPRAR
RLAKEKGIDLSKIRGTGPGGMITEDDVIRELENIEKGMKFTATGLRVKEVIPMSVIRQEI
SRRMVQSLQTMAQVTLSIEINANSLVKMKNEIESKYSMKITYTDILVKVVAKLLRDHPYL
NATLEGDQIKIIEEVNIGIAVALDQGLIVPVIRNADTKPITEIAKESHELADKARENKLN
PDEVSGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRRAPVVVGDNISIGYIMWLSL
TFDHRVMDGHTAAKFLKELTEILEDENKLRTFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgcctaagttaggcttaaccatgacaaaagggaaaatagtt
caatggaagaaaaaggaaggtgacagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactacagtaaaatcaccagttagtggtatcctacttaagatttac
gctaaggaaggtgaagaggtacccgttggtcaaataatagcgtacataggcgaaattgga
gaacaacctccaccctcacctactaaacccgctttagctactcaacaacaacaagcgcaa
ccaattcgaaccgaagaggtaaaggtaataggcgaagtaagagcttcacctagggctaga
agacttgccaaagaaaaaggaatagatctaagtaaaattagggggacaggaccaggcggt
atgataacggaagatgatgtaattagagagctggaaaatatcgaaaaaggaatgaaattc
accgcaactggtcttagggttaaagaagtgataccaatgagtgtaataagacaagaaata
agtagaagaatggttcagagccttcagacaatggcccaagtaacactaagtattgagatt
aatgcaaattcgttagttaaaatgaaaaatgaaatagagtctaagtatagcatgaaaatt
acctatacagatattctagttaaggtagtagctaaactcctcagggaccatccatattta
aacgcaacattagagggagatcaaataaagataattgaagaggttaatataggaatagct
gtggctttggatcaaggattaatagtaccagtaataaggaacgcagatactaagccaatt
actgaaatagcgaaagaaagtcatgaactcgctgataaggccagagagaataagttaaac
cctgatgaagtatctggaggcacgtttacgataagtaatttaggaatgtacgatatagac
tcatttacaccaattataaatcctcctcaaactgccatattgggagtaggtaggataaga
agggcaccagtagtagtaggcgataacatctcaattggttatattatgtggctgagttta
acgttcgatcatagagtgatggatggacatactgcagccaagttcctaaaagagcttact
gaaatattagaggatgaaaacaaattgagaacgtttctaagttag

DBGET integrated database retrieval system