KEGG   Staphylococcus saprophyticus: SSP0524Help
Entry
SSP0524           CDS       T00269                                 

Definition
(GenBank) putative dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
ssp  Staphylococcus saprophyticus
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SSP0524
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SSP0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP AlaDh_PNT_C FAM72
Motif
Other DBs
NCBI-ProteinID: BAE17669
UniProt: Q49ZV5
LinkDB All DBs
Position
556505..557590
Genome map
AA seq 361 aa AA seqDB search
MMSKKNYPETMNAVVAYAPGEYKYETVETPTIEHPKEIVVKVEACGICAGDIKAYGGAPS
FWGDEKQPSYIKAPMIPGHEFIARIVEKGEDVTDFEIGDRVISEQIVPCWNCRFCNRGEY
WMCEKHDLYGFQNNVNGGMAEYMKFTKEAINYKVPEDMPIEKAILIEPYACSLHAIQRAN
IKLGDFVVLSGAGTLGLGMVGAAKKAGAETLVVLDMKDDRLELAKAFGADIVMNPSKVDV
VKEIKDMTEGYGCDTYIEATGHPKSVEQGLSAIRKLGRFVEFSVFGDPVTVDWSIISDRK
ELDLMGSHLGPYCYPLVIDGIQKDDFPTDGVVTHQLPLKDFEEGFELMKKGDQSLKVVLV
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaagaaaaattatcctgaaacaatgaacgcagtagtcgcatacgcgcctgga
gaatataaatatgaaacagttgaaacgccaacgatagaacatcctaaagaaattgttgtg
aaagttgaagcatgtggtatatgtgctggtgatataaaggcttatggcggtgcaccaagt
ttttggggtgatgaaaagcaaccttcatacattaaagcacctatgattccgggacatgaa
tttatagcacgcattgtagaaaaaggagaagatgttacagattttgaaattggagatcgt
gtgatttcagaacaaatcgtaccttgttggaattgtagattctgtaaccgcggcgaatat
tggatgtgtgaaaaacatgatctttatggattccaaaacaatgttaacggtggtatggcg
gaatatatgaaatttactaaagaggctattaattacaaagtaccagaagatatgcctatt
gaaaaagccattttaattgaaccatatgcatgtagcttgcatgccattcaacgtgccaat
attaaattaggtgactttgttgtcctatctggtgccggtacactaggtttaggtatggtt
ggcgcagctaaaaaagcgggtgcggaaacattagtcgtcttagatatgaaagatgatcga
ttagaattagctaaagcatttggtgctgatattgttatgaacccatcaaaagtggatgtt
gtaaaagaaattaaagatatgacagaaggatatggttgtgatacgtatattgaagcaact
ggccatcctaagtctgtagaacaaggtttaagtgcaattagaaaattaggtcgttttgta
gaattttctgtttttggagatccagtcacggtggattggagtattatctctgaccgtaaa
gaattagatttaatgggtagtcacttaggaccttattgttatccattggttatagatggt
attcaaaaagacgacttccctacagatggcgttgtcacacatcaactacctttaaaagat
tttgaagaaggatttgaattgatgaaaaaaggagatcaatcgctaaaagtggttctagta
ccataa

DBGET integrated database retrieval system