KEGG   Staphylococcus saprophyticus: SSP0549Help
Entry
SSP0549           CDS       T00269                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssp  Staphylococcus saprophyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 HlyD_2 Biotin_lipoyl Biotin_lipoyl_2 HlyD SurA_N_3
Motif
Other DBs
NCBI-ProteinID: BAE17694
UniProt: Q49ZT0
LinkDB All DBs
Position
584267..584914
Genome map
AA seq 215 aa AA seqDB search
MKKMVLINIVTIVVLVIIGVVGFHFYNQATGFVSTDNAKVDGEQIKISAPASGEIKSFDV
KNNEKLNKGDKVAEIAAKGEDGQSQNMDVKMPQDGTIVKTDGMEGSMAQAGTPIAYAYNL
DDSYITANVDEKDIADVEEGKDVNVKLDGEDAELKGKVEEVGKATASSFSMMPSSNTDGN
YTKVSQVVPVKISLDSKPSKNVVPGMNAEVKIHKN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatggtattaatcaacatcgttaccattgtagttcttgtgattataggagta
gtcggtttccatttttataatcaagctacaggatttgtaagtactgataatgcgaaagta
gatggagaacaaattaaaatatctgcaccagcatcaggtgaaatcaaatcattcgatgta
aaaaacaatgaaaaattaaataaaggtgataaagttgcagaaattgcagctaaaggtgaa
gatggccaatcacaaaacatggacgttaaaatgccacaagatggtacaatcgtaaaaaca
gatggtatggaaggttcaatggcgcaagcagggactccaattgcttatgcttataattta
gatgattcttacattactgcaaatgttgatgaaaaagatattgcagatgttgaagaaggc
aaagatgtaaatgtaaaacttgacggcgaagacgctgaacttaaaggtaaagtagaagaa
gttggtaaagctacagcttcaagtttctcaatgatgccttcatcaaacactgatggtaat
tatacaaaagtatctcaagttgtacctgtgaaaatttcactcgattcaaaaccatctaaa
aatgttgttccaggaatgaacgctgaagttaaaattcataaaaattaa

DBGET integrated database retrieval system