KEGG   Staphylococcus saprophyticus: SSP0564Help
Entry
SSP0564           CDS       T00269                                 

Definition
(GenBank) ABC-type multidrug transport system ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ssp  Staphylococcus saprophyticus
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssp02000]
    SSP0564
Transporters [BR:ssp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    SSP0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 SMC_N SbcCD_C AAA_13 AAA_15 YozD AAA_23
Motif
Other DBs
NCBI-ProteinID: BAE17709
UniProt: Q49ZR5
LinkDB All DBs
Position
600125..601024
Genome map
AA seq 299 aa AA seqDB search
MSLIIDHVTKKYKNFTAVNDMSLSLEKGKMLGFLGRNGAGKTTTFRMILGLTPITKGSIT
YNDKVIDRSLYNRIGYLPEERGLHPKMKVEDELRYLATLKGMASKDITKAIDYWLKRFDI
TENREKKIESLSKGNQQKIQLLASMLHDPELLILDEPFSGLDPVNVELLKSAVQDLNNAG
TTIIYSSHRMEHVEELCDNVCILNKGELVVSGPIDEVKTNHGNKRVVIETDHEMPEIDKV
DGVLEVDRNKREIKVMIETESVAEQIYDIVKQYGFVKRFQVVEPSLNEIFIDKVGDVNG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaataattgaccatgtaacaaaaaagtataaaaattttactgctgtaaacgat
atgtcactttccttagaaaaaggaaagatgctaggatttttaggaagaaatggcgctggg
aaaacaaccacatttagaatgatattaggattgacacccattacaaagggaagcatcaca
tataatgataaagtaatcgatcgctcgttatataatcgtattggttatttaccagaagaa
cgtggcttacatcctaagatgaaagtagaagacgaattacgttatttagctacattaaaa
ggcatggcatctaaagatattacaaaagcaattgattactggttaaaacgatttgatatt
acagaaaatagagaaaagaaaatcgaatcactttctaaagggaatcaacagaaaattcaa
ttactagcaagtatgctacatgatcctgagttgcttattcttgatgaaccatttagtggt
ttggatccagtgaatgttgaattgctaaagtcggcggttcaagacttaaacaatgcaggt
acgacaattatatatagctctcatagaatggaacatgttgaggaactatgcgataacgta
tgtattttaaataagggagagcttgttgtatcgggtccaattgatgaagtgaaaacgaat
catggcaacaaacgtgtagtcattgaaacagatcacgaaatgccagaaattgataaagta
gatggcgtcctagaggtagacagaaataagagagagattaaagtaatgatagagacagaa
tccgtcgcagaacaaatttatgacatagtgaaacaatatggctttgtgaaacgattccag
gtagtagaaccttcactaaatgaaatatttatagacaaagtaggtgacgttaatggataa

DBGET integrated database retrieval system